APBB2 Antibody - middle region - HRP
Referência ARP55624_P050-HRP
Tamanho : 100ul
Marca : Aviva Systems Biology
APBB2 Antibody - middle region : HRP (ARP55624_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-APBB2 (ARP55624_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human APBB2 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: QNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVS |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-APBB2 (ARP55624_P050-HRP) antibody is Catalog # AAP55624 (Previous Catalog # AAPP36001) |
| Reference | Hong,Q., (er) BMC Mol. Biol. 8, 50 (2007) |
|---|---|
| Gene Symbol | APBB2 |
| Gene Full Name | Amyloid beta (A4) precursor protein-binding, family B, member 2 |
| Alias Symbols | FE65L, FE65L1 |
| NCBI Gene Id | 323 |
| Protein Name | Amyloid beta A4 precursor protein-binding family B member 2 |
| Description of Target | APBB2 may modulate the internalization of beta-amyloid precursor protein.The protein encoded by this gene interacts with the cytoplasmic domains of amyloid beta (A4) precursor protein and amyloid beta (A4) precursor-like protein 2. This protein contains two phosphotyrosine binding (PTB) domains, which are thought to function in signal transduction. |
| Uniprot ID | Q92870 |
| Protein Accession # | NP_775098 |
| Nucleotide Accession # | NM_173075 |
| Protein Size (# AA) | 736 |
| Molecular Weight | 81kDa |
| Protein Interactions | UBC; EGFR; SMURF1; SMAD4; APLP2; APP; |



