AP3M2 Antibody - middle region - HRP

Referência ARP52255_P050-HRP

Tamanho : 100ul

Marca : Aviva Systems Biology

Contactar o distribuidor local :


Telefone : +1 850 650 7790

AP3M2 Antibody - middle region : HRP (ARP52255_P050-HRP)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-AP3M2 (ARP52255_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human AP3M2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 86%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIID
Concentration0.5 mg/ml
Blocking PeptideFor anti-AP3M2 (ARP52255_P050-HRP) antibody is Catalog # AAP52255 (Previous Catalog # AAPP34333)
Subunitmu-2
ReferenceHuang,M.C., (2007) Brain Dev. 29 (8), 462-467
Gene SymbolAP3M2
Gene Full NameAdaptor-related protein complex 3, mu 2 subunit
Alias SymbolsP47B, AP47B, CLA20
NCBI Gene Id10947
Protein NameAP-3 complex subunit mu-2
Description of TargetAP3M2 is part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 3 (AP-3), which belongs to the adaptor complexes medium subunits family. The AP-3 complex plays a role in protein trafficking to lysosomes and specialized organelles.
Uniprot IDP53677
Protein Accession #NP_006794
Nucleotide Accession #NM_006803
Protein Size (# AA)418
Molecular Weight47kDa
Protein InteractionsUBC; GRK5;