Quimigen Portugal > ANXA3 Antibody - C-terminal region - HRP
ANXA3 Antibody - C-terminal region - HRP
Referência ARP36579_T100-HRP
Tamanho : 100ul
Marca : Aviva Systems Biology
Size:100ul
Bulk
Order
Order
Aviva's
Satisfaction
Guarantee
Satisfaction
Guarantee
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- : Antibody & Protein in US
- + /Kit in US
- Contact us for international orders.
ANXA3 Antibody - C-terminal region : HRP (ARP36579_T100-HRP)
| Datasheets/Manuals | Printable datasheet for anti-ANXA3 (ARP36579_T100-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ANXA3 |
| Predicted Homology Based on Immunogen Sequence | Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: RIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ANXA3 (ARP36579_T100-HRP) antibody is Catalog # AAP36579 (Previous Catalog # AAPP07812) |
| Reference | Sekar,M.C., et al., (1996) J. Biol. Chem. 271 (14), 8295-8299 |
|---|---|
| Gene Symbol | ANXA3 |
| Gene Full Name | Annexin A3 |
| Alias Symbols | ANX3 |
| NCBI Gene Id | 306 |
| Protein Name | Annexin A3 |
| Description of Target | This gene, ANXA3, encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation. |
| Uniprot ID | P12429 |
| Protein Accession # | NP_005130 |
| Nucleotide Accession # | NM_005139 |
| Protein Size (# AA) | 323 |
| Molecular Weight | 36kDa |
| Protein Interactions | UBC; ATF2; SNAP23; STXBP2; STX4; ANXA11; ANXA4; ISG15; EMG1; IGSF21; UBR1; UNC119; TP53; REG3A; |
-
ANXA3 Antibody - C-terminal region (ARP36579_T100)Catalog #: ARP36579_T100Species Tested: HumanApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. -
ANXA3 Antibody - N-terminal region (ARP36578_T100)Catalog #: ARP36578_T100Species Tested: HumanApplication: IHC, WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. -
ANXA3 Antibody (OAGA02128)Catalog #: OAGA02128Conjugation: UnconjugatedApplication: IHC-P|WBFormat: Liquid -
ANXA3 ELISA Kit (Human) : 96 Wells (OKEH00384)Catalog #: OKEH00384Application: ELISA-SandwichKit Range: 0.156-10ng/mLSensitivity: 0.078 ng/mL -
ANXA3 ELISA Kit (Rat) (OKEH06305)Catalog #: OKEH06305Application: ELISA-SandwichKit Range: 0.156-10ng/mLSensitivity: 0.078 ng/mL


