AMD1 Antibody - N-terminal region - HRP
Referência ARP54480_P050-HRP
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
AMD1 Antibody - N-terminal region : HRP (ARP54480_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-AMD1 (ARP54480_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human AMD1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGV |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-AMD1 (ARP54480_P050-HRP) antibody is Catalog # AAP54480 (Previous Catalog # AAPP31260) |
| Reference | Guidotti,A., (2007) Neuroreport 18 (1), 57-60 |
|---|---|
| Gene Symbol | AMD1 |
| Gene Full Name | Adenosylmethionine decarboxylase 1 |
| Alias Symbols | AMD, SAMDC, ADOMETDC |
| NCBI Gene Id | 262 |
| Protein Name | S-adenosylmethionine decarboxylase proenzyme |
| Description of Target | The specific function of AMD1 is not yet known.This gene encodes an important intermediate enzyme in polyamine biosynthesis. The polyamines spermine, spermidine, and putrescine are low-molecular-weight aliphatic amines essential for cellular proliferation and tumor promotion. Two alternatively spliced transcript variants that encode different proteins have been identified. |
| Uniprot ID | Q5VXN4 |
| Protein Accession # | NP_001028231 |
| Nucleotide Accession # | NM_001033059 |
| Protein Size (# AA) | 186 |
| Molecular Weight | 21kDa |
| Protein Interactions | ELAVL1; UBC; AMD1; |
