ZNF264 Antibody - middle region - HRP
Referencia ARP31547_P050-HRP
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
ZNF264 Antibody - middle region : HRP (ARP31547_P050-HRP)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-ZNF264 (ARP31547_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZNF264 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Rabbit: 93%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: GKAFSNRADLIRHFSIHTGEKPYECMECGKAFNRRSGLTRHQRIHSGEKP |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ZNF264 (ARP31547_P050-HRP) antibody is Catalog # AAP31547 |
| Gene Symbol | ZNF264 |
|---|---|
| Gene Full Name | zinc finger protein 264 |
| NCBI Gene Id | 9422 |
| Protein Name | zinc finger protein 264 |
| Description of Target | This gene encodes a zinc finger protein and belongs to the krueppel C2H2-type zinc-finger protein family. Zinc finger proteins are often localized in the nucleus, bind nucleic acids, and regulate transcription. |
| Uniprot ID | O43296 |
| Protein Accession # | NP_003408.1 |
| Nucleotide Accession # | NM_003417.4 |
| Protein Size (# AA) | 377 |
| Molecular Weight | 41kDa |
