Wnt2 Antibody - C-terminal region - HRP
Referencia ARP32125_P050-HRP
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
Wnt2 Antibody - C-terminal region : HRP (ARP32125_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-Wnt2 (ARP32125_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: RKYNGAIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDREAG |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Wnt2 (ARP32125_P050-HRP) antibody is Catalog # AAP32125 |
| Gene Symbol | Wnt2 |
|---|---|
| Gene Full Name | Wingless-related MMTV integration site 2 |
| Alias Symbols | M, m-, Int, Irp, Wnt, Mirp, Wnt-, Wnt-2, Wnt2a, Int1l1, 2610510E18Rik |
| NCBI Gene Id | 22413 |
| Protein Name | Protein Wnt-2 |
| Description of Target | Wnt2 is a ligand for members of the frizzled family of seven transmembrane receptors. Wnt2 is a probable developmental protein. Wnt2 may be a signaling molecule which affects the development of discrete regions of tissues. Wnt2 is likely to signal over only few cell diameters. |
| Uniprot ID | P21552 |
| Protein Accession # | NP_076142 |
| Nucleotide Accession # | NM_023653 |
| Protein Size (# AA) | 360 |
| Molecular Weight | 40kDa |
| Protein Interactions | Wnt2b; |
