VP1 Recombinant Protein
Referencia OPCA02149-20UG
embalaje : 20ug
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
VP1 Recombinant Protein (HRV-89) (OPCA02149)
| Datasheets/Manuals | Printable datasheet for VP1 Recombinant Protein (HRV-89) (OPCA02149) |
|---|
| Predicted Species Reactivity | Human Rhinovirus A |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Human rhinovirus A serotype 89 |
| Reconstitution and Storage | -20°C or -80°C |
| Purification | Affinity purified using IMAC |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRPPRAVAYQHTHSTNYIPSNGEATTQIKTRPDVFTVTNV |
| Protein Sequence | Partial Protein: NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRPPRAVAYQHTHSTNYIPSNGEATTQIKTRPDVFTVTNV |
| Source | E.coli |
| Protein Range | 575-866 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | Productive entry pathways of human rhinoviruses.Fuchs R., Blaas D.Adv. Virol. 2012:826301-826301(2012) |
|---|---|
| Alias Symbols | Genome polyprotein [Cleaved into: P1, Capsid protein VP0, VP4-VP2), Capsid protein VP4, P1A, Virion protein 4), Capsid protein VP2, P1B, Virion protein 2), Capsid protein VP3, P1C, Virion protein 3), Capsid protein VP1, P1D, Virion protein 1), P2, Protease 2A, P2A, EC 3.4.22.29, Picornain 2A, Protein 2A), Protein 2B, P2B), Protein 2C, P2C, EC 3.6.1.15), P3, Protein 3AB, Protein 3A, P3A), Viral protein genome-linked, VPg, Protein 3B, P3B), Protein 3CD, EC 3.4.22.28), Protease 3C, EC 3.4.22.28, Picornain 3C, P3C), RNA-directed RNA polymerase, RdRp, EC 2.7.7.48, 3D polymerase, 3Dpol, Protein 3D, 3D)] |
| Protein Name | Genome polyprotein |
| Description of Target | Capsid protein VP1: Forms an icosahedral capsid of pseudo T=3 symmetry with capsid proteins VP2 and VP3. The capsid is 300 Angstroms in diameter, composed of 60 copies of each capsid protein and enclosing the viral positive strand RNA genome. Capsid protein VP1 mainly forms the vertices of the capsid. Capsid protein VP1 interacts with host cell receptor to provide virion attachment to target host cells. This attachment induces virion internalization. Tyrosine kinases are probably involved in the entry process. After binding to its receptor, the capsid undergoes conformational changes. Capsid protein VP1 N-terminus (that contains an amphipathic alpha-helix) and capsid protein VP4 are externalized. Together, they shape a pore in the host membrane through which viral genome is translocated to host cell cytoplasm. After genome has been released, the channel shrinks (By similarity). |
| Uniprot ID | P07210 |
| Protein Size (# AA) | Partial |
| Molecular Weight | 48.6 kDa |