VASP Antibody - middle region - HRP
Referencia ARP61210_P050-HRP
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
VASP Antibody - middle region : HRP (ARP61210_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-VASP (ARP61210_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human VASP |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 92%; Dog: 100%; Guinea Pig: 92%; Horse: 90%; Human: 100%; Mouse: 91%; Rabbit: 92%; Rat: 92%; Yeast: 83% |
| Peptide Sequence | Synthetic peptide located within the following region: WSVPNGPSPEEVEQQKRQQPGPSEHIERRVSNAGGPPAPPAGGPPPPPGP |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-VASP (ARP61210_P050-HRP) antibody is Catalog # AAP61210 (Previous Catalog # AAPP47361) |
| Gene Symbol | VASP |
|---|---|
| Gene Full Name | Vasodilator-stimulated phosphoprotein |
| Alias Symbols | - |
| NCBI Gene Id | 7408 |
| Protein Name | Vasodilator-stimulated phosphoprotein |
| Description of Target | Vasodilator-stimulated phosphoprotein (VASP) is a member of the Ena-VASP protein family. Ena-VASP family members contain an EHV1 N-terminal domain that binds proteins containing E/DFPPPPXD/E motifs and targets Ena-VASP proteins to focal adhesions. In the mid-region of the protein, family members have a proline-rich domain that binds SH3 and WW domain-containing proteins. Their C-terminal EVH2 domain mediates tetramerization and binds both G and F actin. VASP is associated with filamentous actin formation and likely plays a widespread role in cell adhesion and motility. VASP may also be involved in the intracellular signaling pathways that regulate integrin-extracellular matrix interactions. VASP is regulated by the cyclic nucleotide-dependent kinases PKA and PKG. |
| Uniprot ID | P50552 |
| Protein Accession # | NP_003361 |
| Nucleotide Accession # | NM_003370 |
| Protein Size (# AA) | 380 |
| Molecular Weight | 42kDa |
| Protein Interactions | ABI3; FGFR1OP; ABI2; SCGB2A2; CEP250; TP53; XIRP1; UBC; FAT1; FOXK1; PPP4R2; PAAF1; PRPF40A; RPP38; PRMT5; POP7; CUL4B; PSMA5; DDB1; APBB1; YWHAQ; NR4A1; YWHAE; DMRTB1; NPM1; VCAM1; SAT1; ITGA4; FN1; AMOT; SF3B2; SF3A3; ATP6V1F; CPNE3; SRSF9; UBE2N; UAP1; |
