UPB1 antibody - middle region
Referencia ARP42467_T100
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
UPB1 Antibody - middle region (ARP42467_T100)
| Datasheets/Manuals | Printable datasheet for anti-UPB1 (ARP42467_T100) antibody |
|---|
| Publications | Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). 24465277 Molecular profile of 5-fluorouracil pathway genes in colorectal carcinoma. BMC Cancer. 16, 795 (2016). 27733154 |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human UPB1 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: AVVISNSGAVLGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAV |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-UPB1 (ARP42467_T100) antibody is Catalog # AAP42467 (Previous Catalog # AAPS12706) |
| Reference | van (2004) Hum. Mol. Genet. 13 (22), 2793-2801 |
|---|---|
| Gene Symbol | UPB1 |
| Gene Full Name | Ureidopropionase, beta |
| Alias Symbols | BUP1 |
| NCBI Gene Id | 51733 |
| Protein Name | Beta-ureidopropionase |
| Description of Target | UPB1 is a protein that belongs to the CN hydrolase family. Beta-ureidopropionase catalyzes the last step in the pyrimidine degradation pathway. The pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogenase (DHPDH), dihydropyrimidinase (DHP) and beta-ureidopropionase (UP) to beta-alanine and beta-aminoisobutyric acid, respectively. UP deficiencies are associated with N-carbamyl-beta-amino aciduria and may lead to abnormalities in neurological activityThis gene encodes a protein that belongs to the CN hydrolase family. Beta-ureidopropionase catalyzes the last step in the pyrimidine degradation pathway. The pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogenase (DHPDH), dihydropyrimidinase (DHP) and beta-ureidopropionase (UP) to beta-alanine and beta-aminoisobutyric acid, respectively. UP deficiencies are associated with N-carbamyl-beta-amino aciduria and may lead to abnormalities in neurological activity. |
| Uniprot ID | Q9UBR1 |
| Protein Accession # | NP_057411 |
| Nucleotide Accession # | NM_016327 |
| Protein Size (# AA) | 384 |
| Molecular Weight | 42kDa |