TIMELESS antibody - N-terminal region
Referencia ARP38403_T100
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
TIMELESS Antibody - N-terminal region (ARP38403_T100)
| Datasheets/Manuals | Printable datasheet for anti-TIMELESS (ARP38403_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TIMELESS |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%; Sheep: 100%; Zebrafish: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: MDLHMMNCELLATCSALGYLEGDTYHKEPDCLESVKDLIRYLRHEDETRD |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-TIMELESS (ARP38403_T100) antibody is Catalog # AAP38403 (Previous Catalog # AAPP20589) |
| Reference | Murre,C., (2005) Mol. Cell. Biol. 25 (8), 3109-3116 |
|---|---|
| Gene Symbol | TIMELESS |
| Gene Full Name | Timeless homolog (Drosophila) |
| Alias Symbols | TIM, TIM1, hTIM |
| NCBI Gene Id | 8914 |
| Protein Name | Protein timeless homolog |
| Description of Target | The human Timeless protein interacts with both the circadian clock protein cryptochrome 2 and with the cell cycle checkpoint proteins Chk1 and the ATR-ATRIP complex and plays an important role in the DNA damage checkpoint response. Down-regulation of Timeless in human cells seriously compromises replication and intra-S checkpoints, indicating an intimate connection between the circadian cycle and the DNA damage checkpoints that is in part mediated by the Timeless protein. |
| Uniprot ID | Q9UNS1 |
| Protein Accession # | NP_003911 |
| Nucleotide Accession # | NM_003920 |
| Protein Size (# AA) | 1208 |
| Molecular Weight | 139kDa |
| Protein Interactions | UBC; TUT1; TF; XRCC1; FKBP3; SP1; SUMO2; Tipin; Timeless; ZSCAN1; PCBD1; CRY1; PER2; PER1; CLSPN; PCNA; per; Clock; ATRIP; CRY2; CHEK1; |
