Tfam Rabbit Polyclonal Antibody

Referencia TA344229

embalaje : 100ul

Contact local distributor :


Teléfono :

Tfam Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA344229
Rabbit Polyclonal Anti-Tfam Antibody - middle region
 
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human, Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Tfam antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYI
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 28 kDa
Gene Name transcription factor A, mitochondrial
Database Link
Background The function remains unknown.
Synonyms MTTF1; MtTF1; MTTFA; mtTFA; OTTHUMP00000019633; TCF6; TCF6L1; TCF6L2; TCF6L3
Note Immunogen Sequence Homology: Mouse: 100%
Reference Data
Protein Categories Intracellular Proteins, Transciption Factors

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Usted podría estar interesado también en los siguientes productos:



Referencia
Descripción
Cond.
Precio Sin IVA
PB9447
 100ug/vial 
TA341820
 100ul