SPI Protein, Lentinula edodes, Recombinant (His)

Referencia NB-64-51077-500ug

embalaje : 500ug

Marca : Neo Biotech

Contact local distributor :


Teléfono : +1 850 650 7790

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Serine protease inhibitor. Active against beta-trypsin and alpha-chymotrypsin with dissociation constants of 0.35 nM and 40 nM respectively. Inhibits factor XIa, but not other enzymes involved in coagulation and fibrinolysis. Does not inhibit subtilisin, lysyl endopeptidase, arginyl endopeptidase or papain.
Species
Lentinula edodes
Expression System
E. coli
TagN-6xHis
Accession NumberP81639
Synonyms
Serine protease inhibitor
Amino Acid
SLETGRYLIHNGNNIVSRNLAEDRSLNPKRIVLLEPTDKIQLTWIIEKSGDEYILNNRGAPTAHIEDHVFALLIHQEGATKWSIEAVPRHGRNAYIIKGSDGKGWVAPDKAGEQIIYRTLIVGPSEPPTFPLNQVFQIIKLE
Construction
1-142 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight20.0 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Serine protease inhibitor. Active against beta-trypsin and alpha-chymotrypsin with dissociation constants of 0.35 nM and 40 nM respectively. Inhibits factor XIa, but not other enzymes involved in coagulation and fibrinolysis. Does not inhibit subtilisin, lysyl endopeptidase, arginyl endopeptidase or papain.

Dose Conversion

You can also refer to dose conversion for different animals. More