SERPINA4 Antibody - middle region - FITC
Referencia ARP59241_P050-FITC
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
SERPINA4 Antibody - middle region : FITC (ARP59241_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-SERPINA4 (ARP59241_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SERPINA4 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Human: 100%; Zebrafish: 75% |
| Peptide Sequence | Synthetic peptide located within the following region: KGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPK |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SERPINA4 (ARP59241_P050-FITC) antibody is Catalog # AAP59241 (Previous Catalog # AAPP45230) |
| Gene Symbol | SERPINA4 |
|---|---|
| Gene Full Name | Serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 4 |
| Alias Symbols | KAL, KST, PI4, KLST, PI-4, kallistatin |
| NCBI Gene Id | 5267 |
| Protein Name | Kallistatin |
| Description of Target | SERPINA4 inhibits human amidolytic and kininogenase activities of tissue kallikrein. Inhibition is achieved by formation of an equimolar, heat- and SDS-stable complex between the inhibitor and the enzyme, and generation of a small C-terminal fragment of the inhibitor due to cleavage at the reactive site by tissue kallikrein. |
| Uniprot ID | P29622 |
| Protein Accession # | NP_006206 |
| Nucleotide Accession # | NM_006215 |
| Protein Size (# AA) | 427 |
| Molecular Weight | 48kDa |
| Protein Interactions | FN1; RASA1; MAP4K2; MAPK6; ILK; NR4A1; YAE1D1; GADD45G; TAB1; TNFRSF14; TNNT1; KLK2; KLK1; CTSD; |
