Recombinant human Glucagon-like peptide 1 receptor
Referencia OPCA00101-100UG
embalaje : 100ug
Marca : Aviva Systems Biology
GLP1R Recombinant Protein (Human) (OPCA00101)
| Datasheets/Manuals | Printable datasheet for GLP1R Recombinant Protein (Human) (OPCA00101) |
|---|
| Predicted Species Reactivity | Homo sapiens|Human |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Additional Information | Tag information : His tag |
| Reconstitution and Storage | -20°C or -80°C |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY |
| Protein Sequence | RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 24-145 aa |
| Tag | N-terminal 6xHis-tagged |
| Reference | Regulation of GIP and GLP1 receptor cell surface expression by N-glycosylation and receptor heteromerization.Whitaker G.M., Lynn F.C., McIntosh C.H., Accili E.A.PLoS ONE 7:E32675-E32675(2012) |
|---|---|
| Gene Symbol | GLP1R |
| Gene Full Name | glucagon like peptide 1 receptor |
| Alias Symbols | GLP-1, GLP-1 receptor, GLP-1-R, GLP-1R, GLP1 receptor, glucagon-like peptide 1 receptor, seven transmembrane helix receptor. |
| NCBI Gene Id | 2740 |
| Protein Name | Glucagon-like peptide 1 receptor |
| Description of Target | G-protein coupled receptor for glucagon-like peptide 1 (GLP-1) (PubMed:8405712, PubMed:8216285, PubMed:7517895, PubMed:19861722, PubMed:26308095, PubMed:27196125, PubMed:28514449). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels (PubMed:8405712, PubMed:8216285, PubMed:7517895, PubMed:19861722, PubMed:26308095, PubMed:27196125, PubMed:28514449). Plays a role in regulating insulin secretion in response to GLP-1 (By similarity). |
| Uniprot ID | P43220 |
| Protein Size (# AA) | Partial |
| Molecular Weight | 18.3 kDa |


