Rab5a Antibody - middle region - FITC
Referencia ARP61182_P050-FITC
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
Rab5a Antibody - middle region : FITC (ARP61182_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-Rab5a (ARP61182_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: GAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKR |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Rab5a (ARP61182_P050-FITC) antibody is Catalog # AAP61182 |
| Gene Symbol | Rab5a |
|---|---|
| Gene Full Name | RAB5A, member RAS oncogene family |
| Alias Symbols | AI663973, AU021172, nnyRab5a, 2410015H04Rik |
| NCBI Gene Id | 271457 |
| Protein Name | Ras-related protein Rab-5A |
| Description of Target | Rab5a is required for the fusion of plasma membranes and early endosomes. Rab5a contributes to the regulation of filopodia extension. |
| Uniprot ID | Q9CQD1 |
| Protein Accession # | NP_080163 |
| Nucleotide Accession # | NM_025887 |
| Protein Size (# AA) | 215 |
| Molecular Weight | 24kDa |
| Protein Interactions | Eed; Tyr; SNCA; Lmna; |
