- Specifications
Product Description
Rabbit polyclonal antibody raised against a full-length human PSMB8 protein.
Immunogen
PSMB8 (NP_004150.1, 1 a.a. ~ 272 a.a) full-length human protein.
Sequence
MLIGTPTPRDTTPSSWLTSSLLVEAAPLDDTTLPTPVSSGCPGLEPTEFFQSLGGDGERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Tissue lysate)
PSMB8 MaxPab rabbit polyclonal antibody. Western Blot analysis of PSMB8 expression in human kidney.Western Blot (Tissue lysate)
PSMB8 MaxPab rabbit polyclonal antibody. Western Blot analysis of PSMB8 expression in mouse liver.Western Blot (Transfected lysate)
Western Blot analysis of PSMB8 expression in transfected 293T cell line (H00005696-T01) by PSMB8 MaxPab polyclonal antibody.
Lane 1: PSMB8 transfected lysate(29.80 KDa).
Lane 2: Non-transfected lysate.
- Gene Info — PSMB8
Entrez GeneID
5696GeneBank Accession#
NM_004159Protein Accession#
NP_004150.1Gene Name
PSMB8
Gene Alias
D6S216, D6S216E, LMP7, MGC1491, PSMB5i, RING10, beta5i
Gene Description
proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7)
Omim ID
177046Gene Ontology
HyperlinkGene Summary
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 3 (proteasome beta 5 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternative transcripts encoding two isoforms have been identified; both isoforms are processed to yield the same mature subunit. [provided by RefSeq
Other Designations
OTTHUMP00000029420|OTTHUMP00000029421|OTTHUMP00000062981|low molecular weight protein 7|macropain subunit C13|multicatalytic endopeptidase complex subunit C13|protease component C13|proteasome (prosome, macropain) subunit beta type 8 (large multifunctiona
- Interactomes
- Pathways
- Diseases
- Acute Disease
- Alveolitis
- Arthritis
- Asthma
- Bronchiolitis
- Brucellosis
- Cardiovascular Diseases
- Coronary Disease
- Dermatitis
+ View More Disease
PSMB8 purified MaxPab rabbit polyclonal antibody (D01P)
Referencia H00005696-D01P
embalaje : 100ug
Marca : Abnova
Images




