pal Recombinant Protein
Referencia OPCA03157-1MG
embalaje : 1mg
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
PAL Recombinant Protein (Legionella pneumophila) (OPCA03157)
| Datasheets/Manuals | Printable datasheet for PAL Recombinant Protein (Legionella pneumophila) (OPCA03157) |
|---|
| Predicted Species Reactivity | Legionella pneumophila |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Legionella pneumophila |
| Additional Information | Relevance: Very strongly associated with the peptidoglycan |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR |
| Protein Sequence | CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 22-176 aa |
| Tag | N-terminal 6xHis-tagged |
| Reference | Cloning, genetic analysis, and nucleotide sequence of a determinant coding for a 19-kilodalton peptidoglycan-associated protein (Ppl) of Legionella pneumophila.Ludwig B., Schmid A., Marre R., Hacker J.Infect. Immun. 59:2515-2521(1991) |
|---|---|
| Gene Symbol | PAL |
| Alias Symbols | 19 kDa surface antigen, PPL. |
| Protein Name | Peptidoglycan-associated lipoprotein |
| Description of Target | Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity (By similarity). Very strongly associated with the peptidoglycan. |
| Uniprot ID | P26493 |
| Protein Accession # | WP_010947759.1 |
| Nucleotide Accession # | NZ_JRMJ01000023.1 |
| Protein Size (# AA) | Full Length of Mature Protein |
| Molecular Weight | 20.8 kDa |