OTC antibody - N-terminal region
Referencia ARP41766_T100
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
OTC Antibody - N-terminal region (ARP41766_T100)
| Datasheets/Manuals | Printable datasheet for anti-OTC (ARP41766_T100) antibody |
|---|
| Publications | Hallows, W. C. et al. Sirt3 promotes the urea cycle and fatty acid oxidation during dietary restriction. Mol. Cell 41, 139-49 (2011). 21255725 Walters, M. W. & Wallace, K. B. Urea cycle gene expression is suppressed by PFOA treatment in rats. Toxicol. Lett. 197, 46-50 (2010). 20452409 Yu, W. et al. Lysine 88 acetylation negatively regulates ornithine carbamoyltransferase activity in response to nutrient signals. J. Biol. Chem. 284, 13669-75 (2009). 19318352 |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human OTC |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: AFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSAD |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-OTC (ARP41766_T100) antibody is Catalog # AAP41766 (Previous Catalog # AAPP10814) |
| Enhanced Validation | Relative Expression (Western Blot)  |
| Reference | Tanaka,A., (2005) J. Gastroenterol. 40 (1), 106-107 |
|---|---|
| Gene Symbol | OTC |
| Gene Full Name | Ornithine carbamoyltransferase |
| Alias Symbols | OCTD, OTCD |
| NCBI Gene Id | 5009 |
| Protein Name | Ornithine carbamoyltransferase, mitochondrial |
| Description of Target | OTC is a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may play a role in that disease also.This nuclear gene encodes a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may play a role in that disease also. |
| Uniprot ID | P00480 |
| Protein Accession # | NP_000522 |
| Nucleotide Accession # | NM_000531 |
| Protein Size (# AA) | 354 |
| Molecular Weight | 40 kDa |
| Protein Interactions | OTC; TOMM20; |
