OSBPL1A Antibody - middle region - HRP
Referencia ARP45653_P050-HRP
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
OSBPL1A Antibody - middle region : HRP (ARP45653_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-OSBPL1A (ARP45653_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human OSBPL1A |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: EGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFSIWSI |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-OSBPL1A (ARP45653_P050-HRP) antibody is Catalog # AAP45653 (Previous Catalog # AAPP25807) |
| Gene Symbol | OSBPL1A |
|---|---|
| Gene Full Name | Oxysterol binding protein-like 1A |
| Alias Symbols | ORP1, ORP-1, OSBPL1B |
| NCBI Gene Id | 114876 |
| Protein Name | Oxysterol-binding protein-related protein 1 |
| Description of Target | This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. Transcript variants derived from alternative promoter usage and/or alternative splicing exist; they encode different isoforms. |
| Uniprot ID | Q9BXW6 |
| Protein Accession # | NP_542164 |
| Nucleotide Accession # | NM_080597 |
| Protein Size (# AA) | 950 |
| Molecular Weight | 108kDa |
| Protein Interactions | UBC; NPM1; BCL6; |
