Nkx2-5 Antibody - N-terminal region - Biotin
Referencia ARP31575_P050-Biotin
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
Nkx2-5 Antibody - N-terminal region : Biotin (ARP31575_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-Nkx2-5 (ARP31575_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the n terminal region of human Nkx2-5 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 85%; Dog: 85%; Guinea Pig: 92%; Horse: 77%; Human: 100%; Mouse: 92%; Rabbit: 77%; Rat: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: ELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVE |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Nkx2-5 (ARP31575_P050-Biotin) antibody is Catalog # AAP31575 (Previous Catalog # AAPP02354) |
| Reference | Nagel,S., (2008) Leukemia 22 (3), 600-607 |
|---|---|
| Gene Symbol | Nkx2-5 |
| Gene Full Name | NK2 homeobox 5 |
| Alias Symbols | CSX, CSX1, VSD3, CHNG5, HLHS2, NKX2E, NKX2.5, NKX4-1 |
| NCBI Gene Id | 1482 |
| Protein Name | Homeobox protein Nkx-2.5 |
| Description of Target | Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development. It has been demonstrated that a Drosophila homeobox-containing gene called 'tinman' is expressed in the developing dorsal vessel and in the equivalent of the vertebrate heart. Mutations in tinman result in loss of heart formation in the embryo, suggesting that tinman is essential for Drosophila heart formation. Furthermore, abundant expression of Csx, the presumptive mouse homolog of tinman, is observed only in the heart from the time of cardiac differentiation. CSX, the human homolog of murine Csx, has a homeodomain sequence identical to that of Csx and is expressed only in the heart, again suggesting that CSX plays an important role in human heart formation.Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development (Shiojima et al., 1995 [PubMed 7665173]). It has been demonstrated that a Drosophila homeobox-containing gene called 'tinman' is expressed in the developing dorsal vessel and in the equivalent of the vertebrate heart. Mutations in tinman result in loss of heart formation in the embryo, suggesting that tinman is essential for Drosophila heart formation. Furthermore, abundant expression of Csx, the presumptive mouse homolog of tinman, is observed only in the heart from the time of cardiac differentiation. CSX, the human homolog of murine Csx, has a homeodomain sequence identical to that of Csx and is expressed only in the heart, again suggesting that CSX plays an important role in human heart formation.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1211 U34962.1 1-1211 1212-1585 BC025711.1 1143-1516 |
| Uniprot ID | P52952 |
| Protein Accession # | NP_004378 |
| Nucleotide Accession # | NM_004387 |
| Protein Size (# AA) | 324 |
| Molecular Weight | 35kDa |
| Protein Interactions | JARID2; GATA4; KDM6A; SMAD4; CAMTA2; TLE1; HDAC1; ID3; ID2; ID1; HIPK1; HIPK2; FOXH1; TBX5; TBX2; SRF; CSNK2A1; |
