NKX2-3 Antibody - middle region - Biotin
Referencia ARP32191_P050-Biotin
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
NKX2-3 Antibody - middle region : Biotin (ARP32191_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-NKX2-3 (ARP32191_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NKX2-3 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 87%; Dog: 93%; Guinea Pig: 87%; Human: 100%; Mouse: 80%; Rat: 87% |
| Peptide Sequence | Synthetic peptide located within the following region: AHAPPPPPRRVAVPVLVRDGKPCVTPSAQAYGAPYSVGASAYSYNSFPAY |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-NKX2-3 (ARP32191_P050-Biotin) antibody is Catalog # AAP32191 (Previous Catalog # AAPP03164) |
| Reference | Fisher,S.A., (2008) Nat. Genet. 40 (6), 710-712 |
|---|---|
| Gene Symbol | NKX2-3 |
| Gene Full Name | NK2 homeobox 3 |
| Alias Symbols | CSX3, NK2.3, NKX2C, NKX2.3, NKX4-3 |
| NCBI Gene Id | 159296 |
| Protein Name | Homeobox protein Nkx-2.3 |
| Description of Target | NKX2C is a member of the NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintenance of differentiated tissue functions.NKX2C is a member of the NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintenance of differentiated tissue functions. See Harvey (1996) [PubMed 8812123] for a review of the structure, regulation, function, and evolution of NK2 homeobox genes with an emphasis on their roles in heart development.[supplied by OMIM]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by orthologous data and transcript alignments. |
| Uniprot ID | Q8TAU0 |
| Protein Accession # | NP_660328 |
| Nucleotide Accession # | NM_145285 |
| Protein Size (# AA) | 364 |
| Molecular Weight | 38kDa |
| Protein Interactions | ZNF212; GTF2A1L; SRF; |
