- Specifications
Product Description
APC conjugated mouse monoclonal antibody raised against a partial recombinant NBR1.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
NBR1 (NP_005890, 2 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV
Host
Mouse
Reactivity
Human
Conjugation
APC
Preparation Method
Cell Culture Production
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at 4°C.
- Applications
Flow Cytometry
Immunofluorescence
Western Blot
- Gene Info — NBR1
Entrez GeneID
4077GeneBank Accession#
NM_005899Protein Accession#
NP_005890Gene Name
NBR1
Gene Alias
1A1-3B, KIAA0049, M17S2, MIG19
Gene Description
neighbor of BRCA1 gene 1
Omim ID
166945Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene was originally identified as an ovarian tumor antigen monitored in ovarian cancer. The encoded protein contains a B-box/coiled coil motif, which is present in many genes with transformation potential, but the function of this protein is unknown. This gene is located on a region of chromosome 17q21.1 that is in close proximity to tumor suppressor gene BRCA1. Three alternatively spliced variants encoding the same protein have been identified for this gene. [provided by RefSeq
Other Designations
membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125)|migration-inducing protein 19
- Interactomes
- Diseases
NBR1 monoclonal antibody (MA05J), clone 5C3 (APC)
Referencia H00004077-MA05J-3x50ug
embalaje : 3x50ug

