MYBL1 Antibody - middle region - Biotin
Referencia ARP40093_P050-Biotin
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
MYBL1 Antibody - middle region : Biotin (ARP40093_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-MYBL1 (ARP40093_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Yeast |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MYBL1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Dog: 100%; Guinea Pig: 90%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: HVRIHTGEKPYHCDPCGLHFRHKSQLRLHLRQKHGAATNTKVHYHILGGP |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-MYBL1 (ARP40093_P050-Biotin) antibody is Catalog # AAP40093 (Previous Catalog # AAPP21987) |
| Gene Symbol | MYBL1 |
|---|---|
| Gene Full Name | V-myb myeloblastosis viral oncogene homolog (avian)-like 1 |
| Alias Symbols | AMYB, A-MYB |
| NCBI Gene Id | 4603 |
| Protein Name | Myb-related protein A |
| Description of Target | MYBL1 is a strong transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. MYBL1 could have a role in the proliferation and/or differentiation of neurogenic, spermatogenic and B-lymphoid cells. |
| Uniprot ID | Q495F9 |
| Protein Accession # | NP_001138227 |
| Nucleotide Accession # | NM_001080416 |
| Protein Size (# AA) | 752 |
| Molecular Weight | 86kDa |
| Protein Interactions | UBC; CREBBP; Lin54; LIN9; LIN37; NLK; HIPK2; NCL; |
