Foxl2 Antibody - C-terminal region - Biotin

Referencia ARP39574_P050-Biotin

embalaje : 100ul

Marca : Aviva Systems Biology

Contact local distributor :


Teléfono : +1 850 650 7790

Foxl2 Antibody - C-terminal region : Biotin (ARP39574_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-Foxl2 (ARP39574_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Goat, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Rat
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Goat: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: SPATAAPPAPAPTSAPGLQFACARQPELAMMHCSYWDHDSKTGALHSRLD
Concentration0.5 mg/ml
Blocking PeptideFor anti-Foxl2 (ARP39574_P050-Biotin) antibody is Catalog # AAP39574 (Previous Catalog # AAPP21587)
Gene SymbolFoxl2
Gene Full NameForkhead box L2
Alias SymbolsFoxl2
NCBI Gene Id367152
Protein NameProtein Foxl2 Ensembl ENSRNOP00000023091
Description of TargetThe function of Foxl2 remains unknown.
Uniprot IDD4A0S1
Protein Accession #XP_001070279
Nucleotide Accession #XM_001070279
Protein Size (# AA)374
Molecular Weight39kDa