ERCC8 Antibody - N-terminal region - FITC
Referencia ARP32149_P050-FITC
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
ERCC8 Antibody - N-terminal region : FITC (ARP32149_P050-FITC)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-ERCC8 (ARP32149_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB, IHC |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ERCC8 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 77%; Dog: 85%; Guinea Pig: 77%; Human: 100%; Mouse: 85%; Pig: 85%; Rabbit: 85%; Rat: 77%; Zebrafish: 85% |
| Peptide Sequence | Synthetic peptide located within the following region: DVERIHGGGINTLDIEPVEGRYMLSGGSDGVIVLYDLENSSRQSYYTCKA |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ERCC8 (ARP32149_P050-FITC) antibody is Catalog # AAP32149 (Previous Catalog # AAPP03115) |
| Reference | Sarker,A.H., et al., (2005) Mol. Cell 20 (2), 187-198 |
|---|---|
| Gene Symbol | ERCC8 |
| Gene Full Name | Excision repair cross-complementing rodent repair deficiency, complementation group 8 |
| Alias Symbols | CSA, CKN1, UVSS2 |
| NCBI Gene Id | 1161 |
| Protein Name | DNA excision repair protein ERCC-8 |
| Description of Target | ERCC8 is a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS). This gene encodes a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS). CS cells are abnormally sensitive to ultraviolet radiation and are defective in the repair of transcriptionally active genes. |
| Uniprot ID | Q13216 |
| Protein Accession # | NP_000073 |
| Nucleotide Accession # | NM_000082 |
| Protein Size (# AA) | 396 |
| Molecular Weight | 44kDa |
| Protein Interactions | CUL4A; CUL4B; DDB1; RUVBL2; ZNF24; PCNA; H1F0; ERCC6; UVSSA; DDA1; RFWD2; COPS4; COPS6; COPS3; TOP1; TP53; SSBP1; OGG1; MDM2; GTF2H2; CUL5; GPS1; DDB2; COPS2; COPS7A; COPS5; COPS8; RBX1; POLR2A; HMGN1; EP300; UBC; CSNK2B; XAB2; UQCRQ; CBR1; |
