EIF2S1 antibody - C-terminal region
Referencia ARP40508_T100
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
EIF2S1 Antibody - C-terminal region (ARP40508_T100)
| Datasheets/Manuals | Printable datasheet for anti-EIF2S1 (ARP40508_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human EIF2S1 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: RGVFNVQMEPKVVTDTDETELARQMERLERENAEVDGDDDAEEMEAKAED |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-EIF2S1 (ARP40508_T100) antibody is Catalog # AAP40508 (Previous Catalog # AAPP22711) |
| Subunit | 1 |
| Reference | Marciniak,S.J., (2006) J. Cell Biol. 172 (2), 201-209 |
|---|---|
| Gene Symbol | EIF2S1 |
| Gene Full Name | Eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa |
| Alias Symbols | EIF2, EIF-2, EIF2A, EIF-2A, EIF-2alpha |
| NCBI Gene Id | 1965 |
| Protein Name | Eukaryotic translation initiation factor 2 subunit 1 |
| Description of Target | The translation initiation factor eIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, eIF2, and GTP. eIF2 is composed of 3 nonidentical subunits, alpha (36 kD), beta (38 kD), and gamma (52 kD). The rate of formation of the ternary complex is modulated by the phosphorylation state of eIF2-alpha.The translation initiation factor eIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, eIF2, and GTP. eIF2 is composed of 3 nonidentical subunits, alpha (36 kD), beta (38 kD, MIM 603908), and gamma (52 kD, MIM 300161). The rate of formation of the ternary complex is modulated by the phosphorylation state of eIF2-alpha (Ernst et al., 1987).[supplied by OMIM]. |
| Uniprot ID | P05198 |
| Protein Accession # | NP_004085 |
| Nucleotide Accession # | NM_004094 |
| Protein Size (# AA) | 315 |
| Molecular Weight | 35kDa |
| Protein Interactions | HUWE1; UBC; SUMO2; SUMO3; RPA3; RPA2; RPA1; RNF2; EIF2S3; DARS; RPS27L; EEF1E1; AIMP1; EIF2S2; RPLP0; RPL27A; RPL15; RPL13; RPL7A; QARS; MARS; MAP4; TERT; NPM1; MMS19; Dlg4; VCAM1; UPF1; ITGA4; FN1; CSNK2A1; EIF2AK2; NCOA5; POP1; STRN; YBX1; DDX1; TMED9; |
