EDA Antibody - middle region - Biotin
Referencia ARP44519_P050-Biotin
embalaje : 100ul
Marca : Aviva Systems Biology
EDA Antibody - middle region : Biotin (ARP44519_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-EDA (ARP44519_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human EDA |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: HLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTY |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-EDA (ARP44519_P050-Biotin) antibody is Catalog # AAP44519 (Previous Catalog # AAPP12035) |
| Reference | Zhao,J., (2008) Br. J. Dermatol. 158 (3), 614-617 |
|---|---|
| Gene Symbol | EDA |
| Gene Full Name | Ectodysplasin A |
| Alias Symbols | ED1, HED, EDA1, EDA2, HED1, ODT1, XHED, ECTD1, XLHED, ED1-A1, ED1-A2, EDA-A1, EDA-A2, TNLG7C, STHAGX1 |
| NCBI Gene Id | 1896 |
| Protein Name | Ectodysplasin-A |
| Description of Target | EDA is a type II membrane protein that can be cleaved by furin to produce a secreted form. It belongs to the tumor necrosis factor family, acts as a homotrimer and may be involved in cell-cell signaling during the development of ectodermal organs. Defects in this gene are a cause of ectodermal dysplasia, anhidrotic, which is also known as X-linked hypohidrotic ectodermal dysplasia. Several transcript variants encoding many different isoforms have been found for this gene. The protein encoded by this gene is a type II membrane protein that can be cleaved by furin to produce a secreted form. The encoded protein, which belongs to the tumor necrosis factor family, acts as a homotrimer and may be involved in cell-cell signaling during the development of ectodermal organs. Defects in this gene are a cause of ectodermal dysplasia, anhidrotic, which is also known as X-linked hypohidrotic ectodermal dysplasia. Several transcript variants encoding many different isoforms have been found for this gene. |
| Uniprot ID | B7ZLU4 |
| Protein Accession # | NP_001005609 |
| Nucleotide Accession # | NM_001005609 |
| Protein Size (# AA) | 389 |
| Molecular Weight | 41kDa |
| Protein Interactions | OSTCP1; OSTC; NIPAL3; GIMAP5; SEC22A; LEPROTL1; DOLK; PLN; MAL; EMP3; CYB561; ATP6V0C; EDAR; EDA; EDA2R; FURIN; |







