DRAP1 Antibody - N-terminal region - FITC
Referencia ARP31488_P050-FITC
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
DRAP1 Antibody - N-terminal region : FITC (ARP31488_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-DRAP1 (ARP31488_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human DRAP1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-DRAP1 (ARP31488_P050-FITC) antibody is Catalog # AAP31488 (Previous Catalog # AAPP24071) |
| Reference | Schluesche,P., (2007) Nat. Struct. Mol. Biol. 14 (12), 1196-1201 |
|---|---|
| Gene Symbol | DRAP1 |
| Gene Full Name | DR1-associated protein 1 (negative cofactor 2 alpha) |
| Alias Symbols | NC2-alpha |
| NCBI Gene Id | 10589 |
| Protein Name | Dr1-associated corepressor |
| Description of Target | The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the associati |
| Uniprot ID | Q14919 |
| Protein Accession # | NP_006433 |
| Nucleotide Accession # | NM_006442 |
| Protein Size (# AA) | 205 |
| Molecular Weight | 22kDa |
| Protein Interactions | NCK2; POLE3; TAF9B; DRAP1; TAF9; NFYB; LMO2; GTF2B; UBC; HSPBP1; TPD52L2; SUMO3; RAD23B; SRPK2; DR1; APP; KAT2A; DNAJB11; TNFRSF14; TBP; FEZ1; FEZ2; ARHGEF10L; PIK3R3; TTF2; FOXH1; CDKN2C; ZEB1; TK1; IRF1; |
