- Specifications
Product Description
PE conjugated mouse monoclonal antibody raised against a partial recombinant CUX1.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
CUX1 (NP_001904.2, 521 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (50)
Conjugation
PE
Preparation Method
Cell Culture Production
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at 4°C.
- Applications
Flow Cytometry
Immunofluorescence
Western Blot
- Gene Info — CUX1
Entrez GeneID
1523GeneBank Accession#
NM_001913Protein Accession#
NP_001904.2Gene Name
CUX1
Gene Alias
CASP, CDP, CDP/Cut, CDP1, COY1, CUTL1, CUX, Clox, Cux/CDP, GOLIM6, Nbla10317, p100, p110, p200, p75
Gene Description
cut-like homeobox 1
Omim ID
116896Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the homeodomain family of DNA binding proteins. It may regulate gene expression, morphogenesis, and differentiation and it may also play a role in the cell cycle progession. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq
Other Designations
cut homeobox|cut homolog|cut-like 1, CCAAT displacement protein|golgi integral membrane protein 6|putative protein product of Nbla10317
- Interactomes
- Diseases
CUX1 monoclonal antibody (MP01J), clone 2A10 (PE)
Referencia H00001523-MP01J-50ug
embalaje : 50ug

