Cathelicidin antimicrobial peptide Protein, Human, Recombinant (His & Myc & SUMO)

Referencia NB-64-49735-100ug

embalaje : 100ug

Marca : Neo Biotech

Contact local distributor :


Teléfono : +1 850 650 7790

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity. Cathelicidin antimicrobial peptide Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 24.7 kDa and the accession number is P49913.
Species
Human
Expression System
E. coli
TagN-10xHis-SUMO, C-Myc
Accession NumberP49913
Synonyms
FALL39,Cathelicidin antimicrobial peptide,CAP18,CAMP,18 kDa cationic antimicrobial protein (CAP-18;hCAP-18)
Amino Acid
FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Construction
132-170 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight24.7 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.

Dose Conversion

You can also refer to dose conversion for different animals. More