C1orf151 Antibody - middle region
Referencia ARP44801_P050-25UL
embalaje : 25ul
Marca : Aviva Systems Biology
C1orf151 Antibody - middle region (ARP44801_P050)
| Datasheets/Manuals | Printable datasheet for anti-MINOS1 (ARP44801_P050) antibody |
|---|
| Publications | Virginia Guarani, Claude Jardel, Dominique Chretien, Anne Lombès, Paule Benit, Clémence Labasse, Emmanuelle Lacene, Agnès Bourillon, Apolline Imbard, Jean-François Benoist, Imen Dorboz, Mylene Gilleron, Eric S Goetzman, Pauline Gaignard, Abdelhamid Slama, Monique Elmaleh-Bergès, Norma B Romero, Pierre Rustin, Hélène Ogier de Baulny, Joao A Paulo, J Wade Harper, Manuel Schiff. QIL1 mutation causes MICOS disassembly and early onset fatal mitochondrial encephalopathy with liver disease. Elife. 5, (2016). WB 276231471, 123-126 (2016). WB 276263711A1 is a BAR domain protein required for mitochondrial ultrastructure and function. J Cell Biol. 218, 97-111 (2019). WB 304049481, 107541 (2020). 323206511/QIL1 causes hepato-encephalopathy with mitochondrial DNA depletion syndrome. Mol Genet Genomic Med. 8, e1427 (2020). WB 327490731 SORT Drives Disease Pathology in TIMM50-Associated Mitochondrial Disease. Mol Cell Biol. 44, 226-244 (2024). WB 388289981$s> |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human C1orf151 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-MINOS1 (ARP44801_P050) antibody is Catalog # AAP44801 (Previous Catalog # AAPP12277) |
| Enhanced Validation |
| Reference | Gregory,S.G., (2006) Nature 441 (7091), 315-321 |
|---|---|
| Gene Symbol | MINOS1 |
| Gene Full Name | Mitochondrial inner membrane organizing system 1 |
| Alias Symbols | MIO10, Mic10, MINOS1, C1orf151 |
| NCBI Gene Id | 440574 |
| Protein Name | Mitochondrial inner membrane organizing system protein 1 |
| Description of Target | The exact function of C1orf151 remains unknown. |
| Uniprot ID | Q5TGZ0 |
| Protein Accession # | NP_001027535 |
| Nucleotide Accession # | NM_001032363 |
| Protein Size (# AA) | 78 |
| Molecular Weight | 9 kDa |
| Protein Interactions | MIA3; GSTK1; IBA57; RDH13; COA7; DNAJC11; CHCHD3; RMDN1; SAMM50; ACOT9; IMMT; TUBGCP2; MTHFD2; MTX2; TUBG1; MAPK1; MTX1; HSPA9; GDI1; FECH; ACSL4; C1QBP; |




