ASCL2 Antibody - middle region - HRP
Referencia ARP32025_P050-HRP
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
ASCL2 Antibody - middle region : HRP (ARP32025_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-ASCL2 (ARP32025_P050-HRP) antibody |
|---|
| Publications | Park, J.-I. et al. B-cell translocation gene 2: expression in the rat ovary and potential association with adenine nucleotide translocase 2 in mitochondria. Mol. Cell. Endocrinol. 367, 31-40 (2013). IHC, Human, Pig, Dog, Rat, Guinea pig, Bovine, Mouse, Rabbit, Zebrafish 23273993 |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ASCL2 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Rabbit: 77%; Rat: 100%; Zebrafish: 77% |
| Peptide Sequence | Synthetic peptide located within the following region: QALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ASCL2 (ARP32025_P050-HRP) antibody is Catalog # AAP32025 (Previous Catalog # AAPP02926) |
| Reference | Shahib,M.N., (2006) J Reprod Med 51 (11), 892-896 |
|---|---|
| Gene Symbol | ASCL2 |
| Gene Full Name | Achaete-scute complex homolog 2 (Drosophila) |
| Alias Symbols | ASH2, HASH2, MASH2, bHLHa45 |
| NCBI Gene Id | 430 |
| Protein Name | Achaete-scute homolog 2 |
| Description of Target | AS-C proteins are involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system.This gene is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. Involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1649 BC028140.1 1-1649 1650-1864 BC057801.1 1286-1500 |
| Uniprot ID | Q99929 |
| Protein Accession # | NP_005161 |
| Nucleotide Accession # | NM_005170 |
| Protein Size (# AA) | 193 |
| Molecular Weight | 20kDa |
| Protein Interactions | EP300; APEX1; CALM3; CALM1; HCFC1; TUBB; KMT2C; NCOA6; TUBA4A; RBBP5; |
