Zaire ebolavirus (strain Kikwit-95) L Protein (His & Myc)
Referencia NB-64-52404-20ug
embalaje : 20ug
Marca : Neo Biotech
Remove All
Zaire ebolavirus (strain Kikwit-95) L Protein (His & Myc)
(Synonyms: Transcriptase, RNA-directed RNA polymerase L, Replicase, Protein L, Large structural protein) Copy Product InfoSynonyms: Transcriptase, RNA-directed RNA polymerase L, Replicase, Protein L, Large structural protein
Catalog No. TMPH-03735 Copy Product Info
Zaire ebolavirus (strain Kikwit-95) L Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 27.9 kDa and the accession number is Q6V1Q2.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Zaire ebolavirus (strain Kikwit-95) L Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 27.9 kDa and the accession number is Q6V1Q2. |
| Species | ZEBOV |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | Q6V1Q2 |
| Amino Acid | RGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNPPHNLTLENRDNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVMGDNQCITVLSVFPLETDADEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGFIYFGKKQYLNG |
| Construction | 625-809 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Transcriptase, RNA-directed RNA polymerase L, Replicase, Protein L, Large structural protein |
| Research Background | RNA-directed RNA polymerase that catalyzes the transcription of viral mRNAs, their capping and polyadenylation. The template is composed of the viral RNA tightly encapsidated by the nucleoprotein (N). The viral polymerase binds to the genomic RNA at the 3' leader promoter, and transcribes subsequently all viral mRNAs with a decreasing efficiency. The first gene is the most transcribed, and the last the least transcribed. The viral phosphoprotein acts as a processivity factor. Capping is concommitant with initiation of mRNA transcription. Indeed, a GDP polyribonucleotidyl transferase (PRNTase) adds the cap structure when the nascent RNA chain length has reached few nucleotides. Ribose 2'-O methylation of viral mRNA cap precedes and facilitates subsequent guanine-N-7 methylation, both activities being carried by the viral polymerase. Polyadenylation of mRNAs occur by a stuttering mechanism at a slipery stop site present at the end viral genes. After finishing transcription of a mRNA, the polymerase can resume transcription of the downstream gene.; RNA-directed RNA polymerase that catalyzes the replication of viral genomic RNA. The template is composed of the viral RNA tightly encapsidated by the nucleoprotein (N). The replicase mode is dependent on intracellular N protein concentration. In this mode, the polymerase replicates the whole viral genome without recognizing transcriptional signals, and the replicated genome is not caped or polyadenylated. |
| Molecular Weight | 27.9 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
Protein-LL
Related Tags: Zaire ebolavirus (strain Kikwit-95) L Protein (His & Myc) chemical structure | Zaire ebolavirus (strain Kikwit-95) L Protein (His & Myc) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

