WNT5A Antibody - middle region - HRP
Referencia ARP32128_P050-HRP
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
WNT5A Antibody - middle region : HRP (ARP32128_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-WNT5A (ARP32128_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB, IHC |
| Additional Information | IHC Information: Human Brain, Cortex: Formalin-Fixed, Paraffin-Embedded (FFPE) IHC Information: Human Colon, Myenteric Plexus: Formalin-Fixed, Paraffin-Embedded (FFPE) IHC Information: Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE) |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human WNT5A |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 87%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 80% |
| Peptide Sequence | Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-WNT5A (ARP32128_P050-HRP) antibody is Catalog # AAP32128 (Previous Catalog # AAPP23848) |
| Sample Type Confirmation | WNT5A is strongly supported by BioGPS gene expression data to be expressed in HeLa |
| Reference | Witze,E.S., (2008) Science 320 (5874), 365-369 |
|---|---|
| Gene Symbol | WNT5A |
| Gene Full Name | Wingless-type MMTV integration site family, member 5A |
| Alias Symbols | hWNT5A |
| NCBI Gene Id | 7474 |
| Protein Name | Protein Wnt-5a |
| Description of Target | The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT5A is a member of the WNT protein family. It shows 98%, 98% and 87% amino acid identity to the mouse, rat and the xenopus Wnt5A protein, respectively. The experiments performed in Xenopus laevis embryos identified that human frizzled-5 (hFz5) is the receptor for the Wnt5A ligand and the Wnt5A/hFz5 signaling mediates axis induction.The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 98%, 98% and 87% amino acid identity to the mouse, rat and the xenopus Wnt5A protein, respectively. The experiments performed in Xenopus laevis embryos identified that human frizzled-5 (hFz5) is the receptor for the Wnt5A ligand and the Wnt5A/hFz5 signaling mediates axis induction. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | P41221 |
| Protein Accession # | NP_003383 |
| Nucleotide Accession # | NM_003392 |
| Protein Size (# AA) | 380 |
| Molecular Weight | 42kDa |
| Protein Interactions | UBC; LRP6; FZD2; FZD1; ROR2; FZD5; |
