Reactivos e instrumentos para inmunología, biología celular y biología molecular.
 
> USP3 (NM_006537) Human Recombinant Protein

USP3 (NM_006537) Human Recombinant Protein

Imprimir Imprimir
Por favor conéctese

Referencia TP309550

embalaje : 20ug

Contact local distributor :


Teléfono :

USP3 (NM_006537) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP309550
Recombinant protein of human ubiquitin specific peptidase 3 (USP3), 20 µg
 

Other products for "USP3 or NM_006537"

Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209550 representing NM_006537
Red=Cloning site Green=Tags(s)

MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKHYEDAQVPLTN
HKKSEKQDKVQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQNLENSAFTADRHKKRKLLENS
TLNSKLLKVNGSTTAICATGLRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRS
QGDNNVSLVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGF
NGVSRSAILQENSTLSASNKCCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQFRS
KRSKNQENGPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTAYL
RNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTV
TLTDEETVVKAKAYILFYVEHQAKAGSDKL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 58.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006528
Locus ID 9960
UniProt ID Q9Y6I4
Cytogenetics 15q22.31
RefSeq Size 5606
RefSeq ORF 1560
Synonyms SIH003; UBP
Summary Hydrolase that deubiquitinates monoubiquitinated target proteins such as histone H2A and H2B. Required for proper progression through S phase and subsequent mitotic entry. May regulate the DNA damage response (DDR) checkpoint through deubiquitination of H2A at DNA damage sites. Associates with the chromatin.UniProtKB/Swiss-Prot Function
Protein Categories Enzyme: Peptidases, Intracellular Proteins
Protein Families Druggable Genome, Protease
FAQs
  • Protein FAQs
SDS
SKU Description Size
PH309550 USP3 MS Standard C13 and N15-labeled recombinant protein (NP_006528) 10 ug
LC416579 Lyophilized USP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY416579 Transient overexpression lysate of ubiquitin specific peptidase 3 (USP3) (as WB positive control) 100 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Usted podría estar interesado también en los siguientes productos:



Referencia
Descripción
Cond.
Precio Sin IVA