TNF Recombinant Protein
Referencia OPCA02817-100UG
embalaje : 100ug
Marca : Aviva Systems Biology
TNF Recombinant Protein (Sheep) (OPCA02817)
| Datasheets/Manuals | Printable datasheet for TNF Recombinant Protein (Sheep) (OPCA02817) |
|---|
| Predicted Species Reactivity | Ovis aries|Sheep |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Reconstitution and Storage | -20°C or -80°C |
| Peptide Sequence | LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL |
| Source | Yeast |
| Gene Symbol | TNF |
|---|---|
| Gene Full Name | tumor necrosis factor |
| Alias Symbols | cachectin, TNF-a, TNF-alpha, tumor necrosis factor, tumor necrosis factor (TNF superfamily, member 2), tumor necrosis factor alpha, tumor necrosis factor ligand superfamily member 2. |
| NCBI Gene Id | 443540 |
| Protein Name | Tumor necrosis factor |
| Description of Target | Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. |
| Uniprot ID | P23383 |
| Protein Size (# AA) | Partial |
| Molecular Weight | 19.2 kda |

