SMT3 Recombinant Protein
Referencia OPCA02998-100UG
embalaje : 100ug
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
SMT3 Recombinant Protein (Baker's yeast) (OPCA02998)
| Datasheets/Manuals | Printable datasheet for SMT3 Recombinant Protein (Baker's yeast) (OPCA02998) |
|---|
| Predicted Species Reactivity | Saccharomyces cerevisiae |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Reconstitution and Storage | -20°C or -80°C |
| Peptide Sequence | SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG |
| Source | Yeast |
| Gene Symbol | SMT3 |
|---|---|
| Gene Full Name | SUMO family protein SMT3 |
| Alias Symbols | SUMO family protein SMT3, YDR510W. |
| NCBI Gene Id | 852122 |
| Protein Name | Ubiquitin-like protein SMT3 |
| Description of Target | Not known; suppressor of MIF2 mutations. |
| Uniprot ID | Q12306 |
| Protein Size (# AA) | Full Length of Mature Protein |
| Molecular Weight | 13.1 kda |