SLC25A25 Antibody - N-terminal region
Referencia ARP43761_P050-25UL
embalaje : 25ul
Marca : Aviva Systems Biology
SLC25A25 Antibody - N-terminal region (ARP43761_P050)
| Datasheets/Manuals | Printable datasheet for anti-SLC25A25 (ARP43761_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A25 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: AVGLRRLGLHRTEGELQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLV |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SLC25A25 (ARP43761_P050) antibody is Catalog # AAP43761 (Previous Catalog # AAPP25351) |
| Reference | Fiermonte,G., (2004) J. Biol. Chem. 279 (29), 30722-30730 |
|---|---|
| Gene Symbol | SLC25A25 |
| Gene Full Name | Solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25 |
| Alias Symbols | MCSC, PCSCL, SCAMC-2 |
| NCBI Gene Id | 114789 |
| Protein Name | Calcium-binding mitochondrial carrier protein SCaMC-2 |
| Description of Target | The function remains unknown. |
| Uniprot ID | Q6KCM6 |
| Protein Accession # | NP_001006642 |
| Nucleotide Accession # | NM_001006641 |
| Protein Size (# AA) | 503 |
| Molecular Weight | 55kDa |
| Protein Interactions | UBC; |


