SF3B1 Antibody - middle region - HRP
Referencia ARP40248_T100-HRP
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
SF3B1 Antibody - middle region : HRP (ARP40248_T100-HRP)
| Datasheets/Manuals | Printable datasheet for anti-SF3B1 (ARP40248_T100-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SF3B1 |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: LLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADG |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SF3B1 (ARP40248_T100-HRP) antibody is Catalog # AAP40248 (Previous Catalog # AAPP22092) |
| Sample Type Confirmation | SF3B1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
| Subunit | 1 |
| Reference | Strausberg,R.L.,(2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
|---|---|
| Gene Symbol | SF3B1 |
| Gene Full Name | Splicing factor 3b, subunit 1, 155kDa |
| Alias Symbols | MDS, PRP10, Hsh155, PRPF10, SAP155, SF3b155 |
| NCBI Gene Id | 23451 |
| Protein Name | Splicing factor 3B subunit 1 |
| Description of Target | SF3B1 is the subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. |
| Uniprot ID | O75533 |
| Protein Accession # | AAH56155 |
| Nucleotide Accession # | NM_001005526 |
| Protein Size (# AA) | 789 |
| Molecular Weight | 87kDa |
| Protein Interactions | SART3; SUMO2; SUMO3; MDM2; STAU1; UBC; LGR4; WWOX; RPA3; RPA2; RPA1; ERG; EED; RNF2; EZH2; SUZ12; APBB1; PRPF40A; WBP4; TCERG1; FBXO6; RBM17; SNIP1; SF3B6; WHSC1; RPS2; RPL23A; RPL18A; RPL10; RPL3; PLRG1; SMAD9; SMAD5; SMAD1; IL7R; FN1; ESR1; CSNK2A1; EIF |
