RHD recombinant protein

Specifications RHD recombinant protein

Product name	PX-P5200-100
Uniprot ID	Q02161
Uniprot link	https://www.uniprot.org/uniprot/Q02161
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	SSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALG
Molecular weight	36.51 kDa
Protein delivered with Tag?	N-GST Tag
Purity estimated	>90% as determined by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ser2-Gly87
Protein Accession	Q02161
Aliases /Synonyms	CD240D, RHXIII, Blood group Rh(D) polypeptide, Rh polypeptide 2, RhPII, Rhesus D antigen
Reference	PX-P5200
Note	For research use only
Molecular Constructor	Ser2–Gly87 N-GST

Product name	PX-P5200-1MG
Uniprot ID	Q02161
Uniprot link	https://www.uniprot.org/uniprot/Q02161
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	SSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALG
Molecular weight	36.51 kDa
Protein delivered with Tag?	N-GST Tag
Purity estimated	>90% as determined by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ser2-Gly87
Protein Accession	Q02161
Aliases /Synonyms	CD240D, RHXIII, Blood group Rh(D) polypeptide, Rh polypeptide 2, RhPII, Rhesus D antigen
Reference	PX-P5200
Note	For research use only
Molecular Constructor	Ser2–Gly87 N-GST

Product name	PX-P5200-50
Uniprot ID	Q02161
Uniprot link	https://www.uniprot.org/uniprot/Q02161
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	SSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALG
Molecular weight	36.51 kDa
Protein delivered with Tag?	N-GST Tag
Purity estimated	>90% as determined by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ser2-Gly87
Protein Accession	Q02161
Aliases /Synonyms	CD240D, RHXIII, Blood group Rh(D) polypeptide, Rh polypeptide 2, RhPII, Rhesus D antigen
Reference	PX-P5200
Note	For research use only
Molecular Constructor	Ser2–Gly87 N-GST

Documents

• Datasheet
• MSDS

3D Representation

Reviews

There are no reviews yet.

Be the first to review “RHD recombinant protein” Cancel reply