Recombinant SARS-CoV-2, RBD Protein

Referencia S851-1

embalaje : 1.0mg

Marca : Leinco Technologies

Contact local distributor :


Teléfono : +1 850 650 7790

Recombinant SARSCoV2, RBD Protein

Product No.: S851

Alternate Names
Spike Protein, SARSCoV2 Spike Protein, S1 Protein, S1 Subunit, S Protein, Receptor Binding Domain, RBD
Product Type
Recombinant Protein
Expression Host
HEK293 Cells
Species
SARSCoV2
Virus
Applications
ELISA

Data

RBD Protein (S851) dataPurified SARSCoV2 Receptor Binding Domain (RBD) Spike Protein under nonreducing conditions (Prod. No. S851)

Background

Severe acute respiratory syndrome coronavirus 2 (SARSCoV2), the causative agent of coronavirus disease 2019 (COVID19), is an enveloped, singlestranded, positivesense RNA virus that belongs to the Coronaviridae family 1. The SARSCoV2 genome, which shares 79.6% identity with SARSCoV, encodes four essential structural proteins: the spike (S), envelope (E), membrane (M), and nucleocapsid protein (N) 2. The S protein is a transmembrane, homotrimeric, class I fusion glycoprotein that mediates viral attachment, fusion, and entry into host cells 3. Each ~180 kDa monomer contains two functional subunits, S1 (~700 a.a) and S2 (~600 a.a), that mediate viral attachment and membrane fusion, respectively. S1 contains two major domains, the Nterminal (NTD) and Cterminal domains (CTD). The CTD contains the receptorbinding domain (RBD), which binds to the angiotensinconverting enzyme 2 (ACE2) receptor on host cells 35. Although both SARSCoV and SARSCoV2 bind the ACE2 receptor, the RBDs only share ~73% amino acid identity, and the SARSCoV2 RBD binds with a higher affinity compared to SARSCoV 3, 6. The RBD is dynamic and undergoes hingelike conformational changes, referred to as the “down” or “up” conformations, which hide or expose the receptorbinding motifs, respectively 7. Following receptor binding, S1 destabilizes, and TMPRSS2 cleaves S2, which undergoes a pre to postfusion conformation transition, allowing for membrane fusion 8, 9.

Polyclonal RBDspecific antibodies can block ACE2 binding 10, 11, and antiRBD neutralizing antibodies are present in the sera of convalescent COVID19 patients 12, identifying the RBD as an attractive candidate for vaccines and therapeutics. In addition, the RBD is poorly conserved, making it a promising antigen for diagnostic tests 13 14. Serologic tests for the RBD are highly sensitive and specific for detecting SARSCoV2 antibodies in COVID19 patients 13 15. Furthermore, the levels of antiRBD antibodies correlated with SARSCoV2 neutralizing antibodies, suggesting the RBD could be used to predict an individual's risk of disease 13.

Protein Details

Format
Purified No Carrier Protein
Purity
>95% by SDS Page
Product Concentration
0.5 mg/ml
Endotoxin Level
<0.10 EU per 1 μg of the protein by the LAL method
Protein Accession No.
Amino Acid Sequence
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN SNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGF QPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESN KKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCS
State of Matter
Sterile Liquid
Predicted Molecular Mass
The predicted molecular mass is ~33 kDa.
Predicted Molecular Mass
~33 kDa
Formulation
This recombinant protein is aseptically packaged and formulated in 0.01 M phosphate buffered saline (PBS) pH 7.2 7.4, 150 mM NaCl with no carrier protein, potassium, calcium or preservatives added. Due to inherent biochemical properties of proteins, certain products may be prone to precipitation over time. Precipitation may be removed by aseptic centrifugation and/or filtration.
Storage and Stability
This recombinant protein may be stored as received at 28°C for up to one month. For longer term storage, aseptically aliquot in working volumes without diluting and store at 80°C. Avoid Repeated Freeze Thaw Cycles.
Country of Origin
USA
Shipping
Next Day Ice Pack
NCBI Gene Bank
Applications and Recommended Usage ?
(Quality Tested by Leinco)
ELISA

References & Citations

1. Zhou, P., Yang, X., Wang, X. et al. Nature 579, 270–273. 2020.
2. Wu, F., Zhao, S., Yu, B. et al. Nature 579, 265–269. 2020.
3. Wrapp D, Wang N, Corbett KS, et al. bioRxiv. 2020.02.11.944462. 2020.
4. Walls AC, Park YJ, Tortorici MA, Wall A, McGuire AT, Veesler D. Cell. 181(2):281292.e6. 2020.
5. Li W, Zhang C, Sui J, et al. EMBO J. 24(8):16341643. 2005.
6. Shang, J., Ye, G., Shi, K. et al. Nature 581, 221–224. 2020.
7. Gui M, Song W, Zhou H, et al. Cell Res. 27(1):119129. 2017.
8. Walls AC, Tortorici MA, Snijder J, et al. Proc Natl Acad Sci U S A. 114(42):1115711162. 2017.
9. Hoffmann M, KleineWeber H, Schroeder S, et al. Cell. 181(2):271280.e8. 2020.
10. Huo J, Zhao Y, Ren J, et al. Cell Host Microbe. S19313128(20)303516. 2020.
11. Tai, W., He, L., Zhang, X. et al. Cell Mol Immunol 17, 613–620. 2020.
12. Cao Y, Su B, Guo X, et al. Cell. 182(1):7384.e16. 2020.
13. Premkumar L, SegoviaChumbez B, Jadi R, et al. medRxiv; 2020.
14. Quinlan BD, Mou H, Zhang L, et al. bioRxiv; 2020.
15. Olba NM, Muller MA, Li W, et al. medRxiv; 2020.