Recombinant Mouse C-X-C motif chemokine 3 protein
Referencia OPCA00806-20UG
embalaje : 20ug
Marca : Aviva Systems Biology
CXCL3 Recombinant Protein (Mouse) (OPCA00806)
| Datasheets/Manuals | Printable datasheet for CXCL3 Recombinant Protein (Mouse) (OPCA00806) |
|---|
| Predicted Species Reactivity | Mouse|Mus musculus |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Additional Information | Tag information : His tag |
| Reconstitution and Storage | -20°C or -80°C |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | SELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS |
| Protein Sequence | SELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 32-100 aa |
| Tag | N-terminal 6xHis-tagged |
| Reference | IL-10-conditioned dendritic cells, decommissioned for recruitment of adaptive immunity, elicit innate inflammatory gene products in response to danger signals.Nolan K.F., Strong V., Soler D., Fairchild P.J., Cobbold S.P., Croxton R., Gonzalo J.-A., Rubio A., Wells M., Waldmann H.J. Immunol. 172:2201-2209(2004) |
|---|---|
| Gene Symbol | Cxcl3 |
| Gene Full Name | chemokine (C-X-C motif) ligand 3 |
| Alias Symbols | C-X-C motif chemokine 3, Dci, Dcip1, dendritic cell inflammatory protein 1, Gm1960. |
| NCBI Gene Id | 330122 |
| Protein Name | C-X-C motif chemokine 3 |
| Description of Target | Ligand for CXCR2. Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. |
| Uniprot ID | Q6W5C0 |
| Protein Size (# AA) | Full Length of Mature Protein |
| Molecular Weight | 11.6 kDa |


