Quimigen Portugal > Recombinant human Interferon alpha-2
Recombinant human Interferon alpha-2
Marca : Aviva Systems Biology
IFNA2 Recombinant Protein (Human) (OPCA00279)
| Datasheets/Manuals | Printable datasheet for IFNA2 Recombinant Protein (Human) (OPCA00279) |
|---|
| Predicted Species Reactivity | Homo sapiens|Human |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Additional Information | Tag information : His tag |
| Reconstitution and Storage | -20°C or -80°C |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
| Protein Sequence | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 24-188 aa |
| Tag | N-terminal GST-tagged |
| Reference | The consensus coding sequences of human breast and colorectal cancers.Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. , Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.Science 314:268-274(2006) |
|---|---|
| Gene Symbol | IFNA2 |
| Gene Full Name | interferon alpha 2 |
| Alias Symbols | alpha-2a interferon, IFN-alpha-2, IFN-alphaA, IFNA, IFNA2B, interferon alpha 2a, interferon alpha 2b, interferon alpha A, interferon alpha-2, Interferon alpha-A, leIF A. |
| NCBI Gene Id | 3440 |
| Protein Name | Interferon alpha-2 |
| Description of Target | Produced by macrophages, IFN-alpha have antiviral activities. |
| Uniprot ID | P01563 |
| Protein Size (# AA) | Full Length of Mature Protein |
| Molecular Weight | 46.2 kDa |
Protein interactions
| Name | # of Products |
|---|---|
| IFNAR1 | 93 |
| IFNAR2 | 35 |
Biological pathways
| Name | # of Products |
|---|---|
| Blood coagulation | 747 |
| Cell-cell signaling | 763 |
| Induction of apoptosis | 395 |
| Inflammatory response | 911 |
| Negative regulation of interleukin-13 secretion | 6 |
| Negative regulation of interleukin-5 secretion | 6 |
| Negative regulation of T cell differentiation | 18 |
| Negative regulation of T-helper 2 cell cytokine production | 18 |
| Negative regulation of transcription, DNA-dependent | 660 |
| Regulation of type I interferon-mediated signaling pathway | 71 |
| Response to virus | 401 |
| Type I interferon-mediated signaling pathway | 159 |
Biological process
| Name | # of Products |
|---|---|
| Blood coagulation | 396 |
| Cell surface receptor signaling pathway | 179 |
| Cell-cell signaling | 235 |
| Cytokine-mediated signaling pathway | 229 |
| Induction of apoptosis | 226 |
| Inflammatory response | 339 |
| Innate immune response | 300 |
| Negative regulation of gene expression | 70 |
| Negative regulation of interleukin-13 secretion | 1 |
| Negative regulation of interleukin-5 secretion | 1 |
| Negative regulation of T cell differentiation | 10 |
| Negative regulation of T-helper 2 cell cytokine production | 5 |
| Negative regulation of transcription, DNA-dependent | 520 |
| Regulation of type I interferon-mediated signaling pathway | 17 |
| Response to virus | 137 |
| Type I interferon-mediated signaling pathway | 46 |
Cellular components
| Name | # of Products |
|---|---|
| Extracellular region | 1573 |
| Extracellular space | 884 |
Protein function
| Name | # of Products |
|---|---|
| Cytokine activity | 1104 |
| Interferon-alpha/beta receptor binding | 22 |
| Protein binding | 12191 |
-
IFNA2 ELISA Kit (Human) : 96 Wells (OKEH01746)Catalog #: OKEH01746Application: ELISA-SandwichKit Range: 15.6-1000pg/mLSensitivity: 10 pg/mL -
IFNA2 ELISA Kit (Mouse) (OKEH01747)Catalog #: OKEH01747Application: ELISA-SandwichKit Range: 15.6-1000pg/mLSensitivity: 8.2 pg/mL -
IFNA2 ELISA Kit (Mouse) (OKEH03517)Catalog #: OKEH03517Application: ELISA-SandwichKit Range: 7.8-500pg/mLSensitivity: 3.9 pg/mL -
IFNA2 Recombinant Protein (OPCD04128)Catalog #: OPCD04128Conjugation: UnconjugatedApplication: Ctrl (+), SDS-PAGE, WBFormat: Freeze-dried Powder. PBS, pH7.4, containing 0.01% SKL, 5% Trehalose. -
IFNA2 Chemi-Luminescent ELISA Kit (Human) (OKCD03586)Catalog #: OKCD03586Application: CLIAKit Range: 1.37-1,000pg/mLSensitivity: 1.37 pg/mL


