Recombinant Chikungunya Envelope Protein E2 (strain SL-CK1)

Referencia C446-100

embalaje : 100ug

Marca : Leinco Technologies

Contact local distributor :


Teléfono : +1 850 650 7790

Recombinant Chikungunya Envelope Protein E2 (strain SLCK1)

Product No.: C446

Alternate Names
CHIK, CHIKV, Envelope protein, Envelope protein 2, Envelope protein E2, E2 protein, E2
Product Type
Recombinant Protein
Expression Host
HEK293 Cells
Applications
ELISA
WB

Data

SDS Page of Recombinant Chikungunya E2 protein Leinco Prod. No.: C446SDSPAGE
R: 5µg reduced Recombinant Chikungunya E2 protein, (Leinco Prod. No.: C446)
Purified Recombinant Chikungunya E2 protein western blot data Leinco Prod. No.: C446Western Blot
Purified Recombinant Chikungunya E2 protein (Leinco Prod. No.: C446) was separated on SDSPAGE under reducing conditions and probed with an antiChikungunya E2 antibody (Leinco Prod. No.: LT569).
Direct binding of Chikungunya E2 antibody  Leinco Prod. No.: C446Direct binding of Recombinant antiChikungunya E2 antibody (Leinco Prod. No.: LT569) to Chikungunya E2 protein (Leinco Prod. No.: C446).
Binding was measured by ELISA. Chikungunya E2 was immobilized at 1 µg/mL. AntiChikungunya E2 antibody was titrated.
Sandwich ELISA binding of Chikungunya E2 Protein Leinco Prod. No.: C446Sandwich ELISA binding of AntiChikungunya E2 antibody clone 35 (Leinco Prod. No.: LT569) to Recombinant Chikungunya E2 protein (Leinco Prod. No.: C446).
Binding was measured by Sandwich ELISA. AntiChikungunya E2 antibody clone 35, capture reagent, was immobilized at 1 µg/mL. Chikungunya E2 protein was titrated. AntiChikungunya E2 antibody clone 35 (Leinco Prod. No.: LT569), detection reagent, was diluted to 1ug/mL.

Background

Chikungunya virus (CHIKV) is a mosquitotransmitted alphavirus that causes epidemics globally and has been declared a notable disease by the Centers for Disease Control and Prevention1, 2. Symptoms include high fever, myalgia, rash, and severe polyarthritis which can persist for long after acute infection. CHIKV is an enveloped virus with an 11.8kb singlestranded, positivesense RNA genome with two open reading frames3, 4. There are three main genotypes, having 95.2 to 99.8% amino acid identity: Asian, West African, and East/Central/South African (ECSA). The mature CHIKV virion is comprised of a nucleocapsid protein C and two glycoproteins, E1 and E2 5. E1 participates in virus fusion. E2 functions in attachment to cells. E1 and E2 form 80 trimeric spikes on the virus surface6. E2 localizes to the top of the spike and contains three domains: Nterminal domain A (center), domain B (tip), and Cterminal domain C (proximal to the viral membrane)5.

The SLCK1 CHIKV strain was isolated from an epidemic in Sri Lanka in 2007 from a human source and has been fully sequenced (Genbank ID HM045801.1)7. Residue 18 of strain SLCK1 E2 is a histidine8. This residue is an important determinant of virus fitness in mosquito cells.

Soluble recombinant CHIKV E2 protein has been used to generate monoclonal antibodies5.

Protein Details

Species
Viral
Format
Purified No Carrier Protein
Purity
≥90% by SDS PAGE
Endotoxin Level
<1.0 EU/µg
Protein Accession No.
H1ZYM0, H1ZYM0CHIKV
Amino Acid Sequence
stkdnfnvykatrpylahcpdcgeghschspvalerirneatdgtlkiqvslqigiktddshdwtklrymdnhmpadaeraglfvrtsapctitgtmghfilarcpkgetltvgftdsrkishscthpfhhdppvigrekfhsrpqhgkelpcstyvqstaatteeievhmppdtpdrtlmsqqsgnvkitvngqtvrykcncggsnegltttdkvinnckvdqchaavtnhkkwqynsplvprnaelgdrkgkihipfplanvtcrvpkarnptvtygknqvimllypdhptllsyrnmgeepnyqeewvmhkkevvltvpteglevtwgnnepykywpq
Nterminal Sequence Analysis
NP
State of Matter
Lyophilized
SDSPage Molecular Weight
47 kDa
Predicted Molecular Mass
47 kDa
Formulation
Lyophilized from 0.01M Phosphate Buffered Saline (150mM NaCl)(PBS) pH 7.4, with 5% Trehalose and 10mM DTT
Reconstitution
Reconstitute at 1mg/ml using filtered 1x PBS. Gently mix by vortexing and/or inversion until fully dissolved. Centrifuge if necessary.
Storage and Stability
1 month, 2 to 8 °C. Sterile conditions after opening and reconstitution. 1 year from date of receipt, 20 to 80 °C as supplied 3 months from date of receipt, 20 to 80 °C. Sterile conditions after opening and reconstitution.
Country of Origin
USA
Shipping
Ambient
Ligand/Receptor
Ligand
Species
Viral
Regulatory Status
Research Use Only
NCBI Gene Bank
UniProt.org
H1ZYM0
Applications and Recommended Usage ?
(Quality Tested by Leinco)
ELISA,
Western Blot

References & Citations

1. Barrera, R., Hunsperger, E., Lanciotti, RS. et al. Preparedness and response for chikungunya virus introduction in the Americas. Pan American Health Organization; National Center for Emerging and Zoonotic Infectious Diseases (U.S.). Division of VectorBorne Diseases. 2011.
2. Silva, JVJ Jr., LudwigBegall, LF., OliveiraFilho, EF. et al. Acta Trop. 188:213224. 2018.
3. Powers, AM., Brault, AC., Tesh, RB. et al. J. Gen. Virol. 81:471–479. 2000.
4. Arankalle, VA., Shrivastava, S., Cherian, S. et al. J. Gen. Virol. 88:1967–1976. 2007.
5. Pal, P., Dowd, KA., Brien, JD. et al. PLoS Pathog. 9(4):e1003312. 2013.
6. Mukhopadhyay, S., Zhang, W., Gabler, S. et al. Structure. 14(1):6373. 2006.
7. Volk SM, Chen R, Tsetsarkin KA, et al. J Virol. 84(13):6497504. 2010.
8. Jupille HJ, MedinaRivera M, Hawman DW, et al. J Virol. 87(10):597084. 2013.