Recombinant Chikungunya Envelope Protein E2 (strain SL-CK1)
Referencia C446-500
embalaje : 500ug
Marca : Leinco Technologies
Recombinant Chikungunya Envelope Protein E2 (strain SLCK1)
Recombinant Chikungunya Envelope Protein E2 (strain SLCK1)
Product No.: C446
Alternate Names CHIK, CHIKV, Envelope protein, Envelope protein 2, Envelope protein E2, E2 protein, E2 Product Type Recombinant Protein Expression Host HEK293 Cells Applications ELISA ⋅ WB |
Data
SDSPAGE R: 5µg reduced Recombinant Chikungunya E2 protein, (Leinco Prod. No.: C446)
Western Blot Purified Recombinant Chikungunya E2 protein (Leinco Prod. No.: C446) was separated on SDSPAGE under reducing conditions and probed with an antiChikungunya E2 antibody (Leinco Prod. No.: LT569).
Direct binding of Recombinant antiChikungunya E2 antibody (Leinco Prod. No.: LT569) to Chikungunya E2 protein (Leinco Prod. No.: C446). Binding was measured by ELISA. Chikungunya E2 was immobilized at 1 µg/mL. AntiChikungunya E2 antibody was titrated.
Sandwich ELISA binding of AntiChikungunya E2 antibody clone 35 (Leinco Prod. No.: LT569) to Recombinant Chikungunya E2 protein (Leinco Prod. No.: C446). Binding was measured by Sandwich ELISA. AntiChikungunya E2 antibody clone 35, capture reagent, was immobilized at 1 µg/mL. Chikungunya E2 protein was titrated. AntiChikungunya E2 antibody clone 35 (Leinco Prod. No.: LT569), detection reagent, was diluted to 1ug/mL.
BackgroundChikungunya virus (CHIKV) is a mosquitotransmitted alphavirus that causes epidemics globally and has been declared a notable disease by the Centers for Disease Control and Prevention1, 2. Symptoms include high fever, myalgia, rash, and severe polyarthritis which can persist for long after acute infection. CHIKV is an enveloped virus with an 11.8kb singlestranded, positivesense RNA genome with two open reading frames3, 4. There are three main genotypes, having 95.2 to 99.8% amino acid identity: Asian, West African, and East/Central/South African (ECSA). The mature CHIKV virion is comprised of a nucleocapsid protein C and two glycoproteins, E1 and E2 5. E1 participates in virus fusion. E2 functions in attachment to cells. E1 and E2 form 80 trimeric spikes on the virus surface6. E2 localizes to the top of the spike and contains three domains: Nterminal domain A (center), domain B (tip), and Cterminal domain C (proximal to the viral membrane)5. The SLCK1 CHIKV strain was isolated from an epidemic in Sri Lanka in 2007 from a human source and has been fully sequenced (Genbank ID HM045801.1)7. Residue 18 of strain SLCK1 E2 is a histidine8. This residue is an important determinant of virus fitness in mosquito cells. Soluble recombinant CHIKV E2 protein has been used to generate monoclonal antibodies5. Protein DetailsSpecies Viral Format Purified No Carrier Protein Purity ≥90% by SDS PAGE Endotoxin Level <1.0 EU/µg Protein Accession No. H1ZYM0, H1ZYM0CHIKV Amino Acid Sequence stkdnfnvykatrpylahcpdcgeghschspvalerirneatdgtlkiqvslqigiktddshdwtklrymdnhmpadaeraglfvrtsapctitgtmghfilarcpkgetltvgftdsrkishscthpfhhdppvigrekfhsrpqhgkelpcstyvqstaatteeievhmppdtpdrtlmsqqsgnvkitvngqtvrykcncggsnegltttdkvinnckvdqchaavtnhkkwqynsplvprnaelgdrkgkihipfplanvtcrvpkarnptvtygknqvimllypdhptllsyrnmgeepnyqeewvmhkkevvltvpteglevtwgnnepykywpq Nterminal Sequence Analysis NP State of Matter Lyophilized SDSPage Molecular Weight 47 kDa Predicted Molecular Mass 47 kDa Formulation Lyophilized from 0.01M Phosphate Buffered Saline (150mM NaCl)(PBS) pH 7.4, with 5% Trehalose and 10mM DTT Reconstitution Reconstitute at 1mg/ml using filtered 1x PBS. Gently mix by vortexing and/or inversion until fully dissolved. Centrifuge if necessary. Storage and Stability 1 month, 2 to 8 °C. Sterile conditions after opening and reconstitution. 1 year from date of receipt, 20 to 80 °C as supplied 3 months from date of receipt, 20 to 80 °C. Sterile conditions after opening and reconstitution. Country of Origin USA Shipping Ambient Ligand/Receptor Ligand Species Viral Regulatory Status Research Use Only NCBI Gene Bank UniProt.org H1ZYM0 Applications and Recommended Usage ? (Quality Tested by Leinco) ELISA, Western Blot References & Citations1. Barrera, R., Hunsperger, E., Lanciotti, RS. et al. Preparedness and response for chikungunya virus introduction in the Americas. Pan American Health Organization; National Center for Emerging and Zoonotic Infectious Diseases (U.S.). Division of VectorBorne Diseases. 2011. 2. Silva, JVJ Jr., LudwigBegall, LF., OliveiraFilho, EF. et al. Acta Trop. 188:213224. 2018. 3. Powers, AM., Brault, AC., Tesh, RB. et al. J. Gen. Virol. 81:471–479. 2000. 4. Arankalle, VA., Shrivastava, S., Cherian, S. et al. J. Gen. Virol. 88:1967–1976. 2007. 5. Pal, P., Dowd, KA., Brien, JD. et al. PLoS Pathog. 9(4):e1003312. 2013. 6. Mukhopadhyay, S., Zhang, W., Gabler, S. et al. Structure. 14(1):6373. 2006. 7. Volk SM, Chen R, Tsetsarkin KA, et al. J Virol. 84(13):6497504. 2010. 8. Jupille HJ, MedinaRivera M, Hawman DW, et al. J Virol. 87(10):597084. 2013. |

