Recombinant Bovine LGB/Beta-lactoglobulin Protein, N-His

Specifications Recombinant Bovine LGB/Beta-lactoglobulin Protein, N-His

Product name	ARO-P11492-100
Uniprot ID	P02754
Origin species	Bovine
Expression system	Prokaryotic expression
Raw Antigen Sequence	LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Molecular weight	21.59 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Leu17-Ile178
Aliases /Synonyms	Beta-lactoglobulin, Beta-LG, Bos d 5, LGB
Reference	ARO-P11492
Note	For research use only.
Molecular Constructor	Leu17–Ile178

Product name	ARO-P11492-1MG
Uniprot ID	P02754
Origin species	Bovine
Expression system	Prokaryotic expression
Raw Antigen Sequence	LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Molecular weight	21.59 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Leu17-Ile178
Aliases /Synonyms	Beta-lactoglobulin, Beta-LG, Bos d 5, LGB
Reference	ARO-P11492
Note	For research use only.
Molecular Constructor	Leu17–Ile178

Product name	ARO-P11492-50
Uniprot ID	P02754
Origin species	Bovine
Expression system	Prokaryotic expression
Raw Antigen Sequence	LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Molecular weight	21.59 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Leu17-Ile178
Aliases /Synonyms	Beta-lactoglobulin, Beta-LG, Bos d 5, LGB
Reference	ARO-P11492
Note	For research use only.
Molecular Constructor	Leu17–Ile178

Documents

• Datasheet

3D Representation

Reviews

There are no reviews yet.

Be the first to review “Recombinant Bovine LGB/Beta-lactoglobulin Protein, N-His” Cancel reply