Pygm Antibody - C-terminal region - HRP
Referencia ARP48678_P050-HRP
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
Pygm Antibody - C-terminal region : HRP (ARP48678_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-Pygm (ARP48678_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 86%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEKI |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Pygm (ARP48678_P050-HRP) antibody is Catalog # AAP48678 (Previous Catalog # AAPP28728) |
| Gene Symbol | Pygm |
|---|---|
| Gene Full Name | Muscle glycogen phosphorylase |
| Alias Symbols | P, PG, AI115133 |
| NCBI Gene Id | 19309 |
| Protein Name | Glycogen phosphorylase, muscle form |
| Description of Target | Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties. |
| Uniprot ID | Q9WUB3 |
| Protein Accession # | NP_035354 |
| Nucleotide Accession # | NM_011224 |
| Protein Size (# AA) | 842 |
| Molecular Weight | 97kDa |
| Protein Interactions | Set; |
