PLIN antibody - N-terminal region
Referencia ARP42057_T100
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
PLIN Antibody - N-terminal region (ARP42057_T100)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-PLIN1 (ARP42057_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Sheep, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PLIN |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 83% |
| Peptide Sequence | Synthetic peptide located within the following region: STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-PLIN1 (ARP42057_T100) antibody is Catalog # AAP42057 (Previous Catalog # AAPP24536) |
| Reference | Moore,H.P., (2005) J. Biol. Chem. 280 (52), 43109-43120 |
|---|---|
| Gene Symbol | PLIN1 |
| Gene Full Name | Perilipin 1 |
| Alias Symbols | PERI, PLIN, FPLD4 |
| NCBI Gene Id | 5346 |
| Protein Name | Perilipin-1 |
| Description of Target | PLIN coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis.The protein encoded by this gene coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The encoded protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis. |
| Uniprot ID | O60240 |
| Protein Accession # | NP_002657 |
| Nucleotide Accession # | NM_002666 |
| Protein Size (# AA) | 522 |
| Molecular Weight | 57kDa |
| Protein Interactions | ABHD5; PLIN1; LIPE; PRKACA; |
