Quimigen Portugal > PDGFB antibody - N-terminal region
PDGFB antibody - N-terminal region
Marca : Aviva Systems Biology
PDGFB Antibody - N-terminal region (ARP58509_P050)
| Datasheets/Manuals | Printable datasheet for anti-PDGFB (ARP58509_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Sheep |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB, IHC |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PDGFB |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-PDGFB (ARP58509_P050) antibody is Catalog # AAP58509 (Previous Catalog # AAPP34718) |
| Sample Type Confirmation | There is BioGPS gene expression data showing that PDGFB is expressed in HEK293T |
| Subunit | B |
| Reference | Chadjichristos,C.E., (2008) Circ. Res. 102 (6), 653-660 |
|---|---|
| Gene Symbol | PDGFB |
| Gene Full Name | Platelet-derived growth factor beta polypeptide |
| Alias Symbols | SIS, SSV, IBGC5, PDGF2, c-sis, PDGF-2 |
| NCBI Gene Id | 5155 |
| Protein Name | Platelet-derived growth factor subunit B |
| Description of Target | PDGFB is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor.The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor. Two splice variants have been identified for this gene. |
| Uniprot ID | P01127 |
| Protein Accession # | NP_002599 |
| Nucleotide Accession # | NM_002608 |
| Protein Size (# AA) | 241 |
| Molecular Weight | 27kDa |
| Protein Interactions | COL6A1; COL5A1; COL4A1; COL3A1; COL2A1; COL1A2; COL1A1; LYVE1; NRP1; ADIPOQ; MDFI; PDAP1; ART1; PDGFB; HRAS; THBS1; PDGFRA; PDGFRB; HSPG2; LRP1; A2M; SPARC; |
Protein interactions
| Name | # of Products |
|---|---|
| A2M | 261 |
| ART1 | 7 |
| COL1A1 | 128 |
| HRAS | 211 |
| HSPG2 | 69 |
| LRP1 | 227 |
| PDAP1 | 16 |
| PDGFB | 59 |
| PDGFRA | 83 |
| PDGFRB | 128 |
| SPARC | 118 |
| THBS1 | 221 |
Biological pathways
| Name | # of Products |
|---|---|
| Activation of protein kinase B activity | 71 |
| Cellular response to mycophenolic acid | 15 |
| Embryonic placenta development | 25 |
| Heart development | 92 |
| Metanephric glomerular mesangial cell development | 8 |
| Monocyte chemotaxis | 65 |
| Negative regulation of phosphatidylinositol biosynthetic process | 13 |
| Negative regulation of platelet activation | 62 |
| Negative regulation of transcription, DNA-dependent | 660 |
| Paracrine signaling | 8 |
| Peptidyl-serine phosphorylation | 97 |
| Peptidyl-tyrosine phosphorylation | 165 |
| Platelet activation | 875 |
| Platelet degranulation | 443 |
| Positive regulation of blood vessel endothelial cell migration | 76 |
| Positive regulation of calcium ion import | 15 |
| Positive regulation of cell division | 223 |
| Positive regulation of chemotaxis | 23 |
| Positive regulation of cyclin-dependent protein kinase activity | 33 |
| Positive regulation of DNA biosynthetic process | 23 |
| Positive regulation of DNA replication | 222 |
| Positive regulation of endothelial cell proliferation | 175 |
| Positive regulation of ERK1 and ERK2 cascade | 194 |
| Positive regulation of fibroblast proliferation | 119 |
| Positive regulation of glomerular filtration | 8 |
| Positive regulation of glomerular mesangial cell proliferation | 8 |
| Positive regulation of MAP kinase activity | 147 |
| Positive regulation of metanephric mesenchymal cell migration by platelet-derived growth factor receptor-beta signaling pathway | 19 |
| Positive regulation of mitosis | 179 |
| Positive regulation of peptidyl-tyrosine phosphorylation | 308 |
| Positive regulation of phosphatidylinositol 3-kinase activity | 98 |
| Positive regulation of phosphatidylinositol 3-kinase cascade | 210 |
| Positive regulation of protein autophosphorylation | 71 |
| Positive regulation of protein tyrosine kinase activity | 27 |
| Positive regulation of reactive oxygen species metabolic process | 55 |
| Positive regulation of smooth muscle cell migration | 54 |
| Positive regulation of smooth muscle cell proliferation | 123 |
| Positive regulation of transcription, DNA-dependent | 694 |
| Reactive oxygen species metabolic process | 36 |
| Transforming growth factor beta receptor signaling pathway | 171 |
Biological process
| Name | # of Products |
|---|---|
| Activation of protein kinase activity | 27 |
| Activation of protein kinase B activity | 12 |
| Blood coagulation | 396 |
| Cell chemotaxis | 24 |
| Cell growth | 42 |
| Cellular response to mycophenolic acid | 4 |
| Embryonic placenta development | 31 |
| Heart development | 186 |
| Hemopoiesis | 78 |
| Metanephric glomerular mesangial cell development | 2 |
| Monocyte chemotaxis | 23 |
| Multicellular organismal development | 896 |
| Negative regulation of phosphatidylinositol biosynthetic process | 4 |
| Negative regulation of platelet activation | 10 |
| Negative regulation of transcription, DNA-dependent | 520 |
| Paracrine signaling | 4 |
| Peptidyl-serine phosphorylation | 61 |
| Peptidyl-tyrosine phosphorylation | 72 |
| Platelet activation | 202 |
| Platelet degranulation | 78 |
| Platelet-derived growth factor receptor signaling pathway | 27 |
| Positive regulation of blood vessel endothelial cell migration | 24 |
| Positive regulation of calcium ion import | 9 |
| Positive regulation of cell division | 67 |
| Positive regulation of cell migration | 150 |
| Positive regulation of cell proliferation | 483 |
| Positive regulation of chemotaxis | 14 |
| Positive regulation of cyclin-dependent protein kinase activity | 11 |
| Positive regulation of DNA biosynthetic process | 8 |
| Positive regulation of DNA replication | 56 |
| Positive regulation of endothelial cell proliferation | 68 |
| Positive regulation of ERK1 and ERK2 cascade | 103 |
| Positive regulation of fibroblast proliferation | 47 |
| Positive regulation of glomerular filtration | 2 |
| Positive regulation of glomerular mesangial cell proliferation | 3 |
| Positive regulation of MAP kinase activity | 56 |
| Positive regulation of MAPK cascade | 81 |
| Positive regulation of metanephric mesenchymal cell migration | 2 |
| Positive regulation of metanephric mesenchymal cell migration by platelet-derived growth factor receptor-beta signaling pathway | 7 |
| Positive regulation of mitosis | 50 |
| Positive regulation of peptidyl-tyrosine phosphorylation | 112 |
| Positive regulation of phosphatidylinositol 3-kinase activity | 39 |
| Positive regulation of phosphatidylinositol 3-kinase cascade | 60 |
| Positive regulation of protein autophosphorylation | 18 |
| Positive regulation of protein tyrosine kinase activity | 17 |
| Positive regulation of reactive oxygen species metabolic process | 31 |
| Positive regulation of smooth muscle cell migration | 26 |
| Positive regulation of smooth muscle cell proliferation | 67 |
| Positive regulation of transcription, DNA-dependent | 681 |
| Protein phosphorylation | 451 |
| Reactive oxygen species metabolic process | 23 |
| Response to drug | 323 |
| Response to estradiol stimulus | 102 |
| Response to hypoxia | 205 |
| Response to insulin stimulus | 68 |
| Response to organic cyclic compound | 128 |
| Response to wounding | 70 |
| Transforming growth factor beta receptor signaling pathway | 95 |
Cellular components
| Name | # of Products |
|---|---|
| Basolateral plasma membrane | 122 |
| Cell surface | 369 |
| Cytoplasm | 4549 |
| Endoplasmic reticulum lumen | 87 |
| Extracellular region | 1573 |
| Golgi membrane | 308 |
| Membrane | 2769 |
| Platelet alpha granule lumen | 42 |
Protein function
| Name | # of Products |
|---|---|
| Cell surface binding | 163 |
| Collagen binding | 197 |
| Eukaryotic cell surface binding | 205 |
| Growth factor activity | 831 |
| Platelet-derived growth factor binding | 66 |
| Platelet-derived growth factor receptor binding | 96 |
| Protein binding | 12191 |
| Protein heterodimerization activity | 1132 |
| Protein homodimerization activity | 1852 |
| Protein tyrosine kinase activity | 369 |
| Superoxide-generating NADPH oxidase activator activity | 11 |
Diseases
| Name | # of Products |
|---|---|
| Proto-oncogene | 793 |
-
Human PDGF BB HOMODIMER Protein (OPSA10941)Catalog #: OPSA10941Application: ELISA|FA|WBFormat: Lyophilized. 30 mM Acetic Acid -
PDGFB Antibody (OALA03933)Catalog #: OALA03933Conjugation: UnconjugatedSpecies Tested: HumanApplication: ELISA|IF|IHC|IHC-PFormat: Liquid. Tris buffered saline (pH 7.3) with 0.5% BSA and 0.02% sodium azide. -
PDGFB ELISA Kit (Human) : 96 Wells (OKEH02860)Catalog #: OKEH02860Application: ELISA-SandwichKit Range: 31.2-2000pg/mLSensitivity: 15 pg/mL -
Pdgfb ELISA Kit (Mouse) : 96 Wells (OKEH02861)Catalog #: OKEH02861Application: ELISA-SandwichKit Range: 31.2-2000pg/mLSensitivity: 15.62 pg/mL -
PDGFB ELISA Kit (Pig) (OKEH03857)Catalog #: OKEH03857Application: ELISA-SandwichKit Range: 78-5000pg/mLSensitivity: 35 pg/mL


