PADI2 Antibody - middle region - HRP
Referencia ARP52328_P050-HRP
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
PADI2 Antibody - middle region : HRP (ARP52328_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-PADI2 (ARP52328_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PADI2 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 83% |
| Peptide Sequence | Synthetic peptide located within the following region: RGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYV |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-PADI2 (ARP52328_P050-HRP) antibody is Catalog # AAP52328 (Previous Catalog # AAPS31309) |
| Reference | Foulquier,C., (2007) Arthritis Rheum. 56 (11), 3541-3553 |
|---|---|
| Gene Symbol | PADI2 |
| Gene Full Name | Peptidyl arginine deiminase, type II |
| Alias Symbols | PAD2, PDI2, PAD-H19 |
| NCBI Gene Id | 11240 |
| Protein Name | Protein-arginine deiminase type-2 |
| Description of Target | PADI2 encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. PADI2 is thought to play a role in the onset and progression of neurodegenerative human disorders, including Alzheimer disease and multiple sclerosis, and it has also been implicated in glaucoma pathogenesis.This gene encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. This enzyme is thought to play a role in the onset and progression of neurodegenerative human disorders, including Alzheimer disease and multiple sclerosis, and it has also been implicated in glaucoma pathogenesis. This gene exists in a cluster with four other paralogous genes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | Q9Y2J8 |
| Protein Accession # | NP_031391 |
| Nucleotide Accession # | NM_007365 |
| Protein Size (# AA) | 665 |
| Molecular Weight | 75kDa |
| Protein Interactions | UBC; |
